Germany
Japan
United Kingdom
China
Biotinylated Anti-Human IL-17E Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human IL-17E |
Antibodies
Download
USD 420.00
In Stock
Mouse Monoclonal ApoE4 Antibody (4E4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-POSTN antibody for SISCAPA, clone OTIR1A5
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-MIME antibody for SISCAPA, clone OTIR4H1
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-CD5L antibody for SISCAPA, clone OTIR1F12
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 750.00
In Stock
Rabbit Polyclonal Anti-CPE Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CPE antibody: synthetic peptide directed towards the N terminal of human CPE. Synthetic peptide located within the following region: GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG |
Rabbit Polyclonal IFN-beta Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta. |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Anti-ADAMTS5 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 529-541 amino acids of Human A disintegrin and metalloproteinase with thrombospondin motifs 5 |
Rabbit Polyclonal Anti-BDNF Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG |
Rabbit polyclonal anti-BDNF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with recombinant truncated human BDNF protein produced in E.coli. |
Rabbit Polyclonal Anti-TINAGL1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TINAGL1 antibody: synthetic peptide directed towards the middle region of human TINAGL1. Synthetic peptide located within the following region: NLIHEPLDQGNCAGSWAFSTAAVASDRVSIHSLGHMTPVLSPQNLLSCDT |
Active filters
Reactivities
- Human
Families
- Secreted Protein
Filter by
Target Symbol
- KLK8 (256)
- EGFR (163)
- LIPG (133)
- IL6 (132)
- MSMB (126)
- CD40 (118)
- LCN2 (116)
- ADIPOQ (110)
- AFP (109)
- IL1RL1 (109)
- CFI (106)
- LGALS3 (102)
- IL17A (99)
- VWF (99)
- F13A1 (94)
- CHGA (79)
- FGF21 (75)
- LOX (74)
- NPPB (73)
- ICOS (68)
- ERBB3 (64)
- FGFR2 (64)
- SYP (64)
- FSHB (63)
- CSF3 (60)
- FGG (60)
- MUC1 (59)
- SERPINB3 (59)
- AGR2 (58)
- HP (58)
- CD163 (57)
- CSF2 (56)
- KLK3 (56)
- APOE (55)
- MSLN (53)
- TNF (53)
- PMEL (52)
- TIMP2 (52)
- SERPINA5 (49)
- VEGFA (49)
- GNAS (48)
- SYT4 (47)
- CRP (46)
- SERPINA1 (46)
- WNT3 (46)
- ACE2 (45)
- CPA1 (45)
- IL20 (45)
- RAB37 (45)
- FCER2 (44)
- REN (44)
- IL1RN (43)
- PRL (41)
- RNASE11 (41)
- SERPINB4 (41)
- TFPI (40)
- TNFRSF18 (40)
- WFDC2 (40)
- APOA5 (39)
- LAMB3 (38)
- IL1A (37)
- LGALS3BP (37)
- P3H1 (37)
- SPP1 (37)
- TFPI2 (37)
- VIP (37)
- AMH (36)
- ALB (35)
- CST2 (35)
- PROZ (35)
- GRN (34)
- IFNG (34)
- CALR (33)
- CCN2 (33)
- SERPINB2 (33)
- CPA2 (32)
- PON3 (32)
- APOL1 (31)
- PON1 (31)
- POSTN (31)
- FN1 (30)
- IGFBP1 (29)
- MASP2 (29)
- TFF1 (29)
- CSF1 (28)
- ERAP1 (28)
- IL24 (28)
- SIL1 (28)
- STX1A (28)
- MSTN (27)
- SERPINE2 (27)
- SPINT1 (27)
- CD8A (26)
- CSF2RA (26)
- IL2 (26)
- MGP (26)
- MTMR14 (26)
- ADAMTS1 (25)
- FGF2 (25)
- FGFBP1 (25)
Applications
Antibody Hosts
Isotypes
Clonalities
Carrier-free
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Pathways
- Cytokine-cytokine receptor interaction (1860)
- Pathways in cancer (1115)
- Jak-STAT signaling pathway (749)
- Complement and coagulation cascades (717)
- MAPK signaling pathway (647)
- Hematopoietic cell lineage (590)
- Focal adhesion (578)
- Toll-like receptor signaling pathway (480)
- Regulation of actin cytoskeleton (464)
- Melanoma (366)
- GnRH signaling pathway (335)
- Allograft rejection (333)
- Endocytosis (329)
- Prostate cancer (324)
- Graft-versus-host disease (321)
- T cell receptor signaling pathway (310)
- Metabolic pathways (307)
- Pancreatic cancer (307)
- Bladder cancer (305)
- NOD-like receptor signaling pathway (297)
- Systemic lupus erythematosus (290)
- ErbB signaling pathway (279)
- Calcium signaling pathway (275)
- TGF-beta signaling pathway (271)
- Asthma (270)
- ECM-receptor interaction (264)
- Hypertrophic cardiomyopathy (HCM) (254)
- Autoimmune thyroid disease (242)
- Type I diabetes mellitus (237)
- Prion diseases (236)
- Epithelial cell signaling in Helicobacter pylori infection (231)
- Primary immunodeficiency (224)
- Cell adhesion molecules (CAMs) (223)
- Gap junction (217)
- Natural killer cell mediated cytotoxicity (210)
- Cytosolic DNA-sensing pathway (205)
- Chemokine signaling pathway (204)
- Adipocytokine signaling pathway (201)
- Hedgehog signaling pathway (201)
- Colorectal cancer (194)
- Glioma (191)
- Neuroactive ligand-receptor interaction (185)
- PPAR signaling pathway (183)
- Melanogenesis (182)
- Fc epsilon RI signaling pathway (180)
- Type II diabetes mellitus (170)
- Non-small cell lung cancer (169)
- Basal cell carcinoma (167)
- Adherens junction (163)
- Dorso-ventral axis formation (163)
- Endometrial cancer (163)
- Wnt signaling pathway (163)
- Apoptosis (162)
- Dilated cardiomyopathy (156)
- Alzheimer's disease (153)
- Glycerolipid metabolism (152)
- RIG-I-like receptor signaling pathway (150)
- Renal cell carcinoma (144)
- mTOR signaling pathway (136)
- Viral myocarditis (127)
- Renin-angiotensin system (118)
- Antigen processing and presentation (111)
- Small cell lung cancer (98)
- Long-term depression (97)
- p53 signaling pathway (81)
- VEGF signaling pathway (73)
- Vascular smooth muscle contraction (72)
- Amyotrophic lateral sclerosis (ALS) (69)
- Regulation of autophagy (62)
- Neurotrophin signaling pathway (61)
- Axon guidance (55)
- Taste transduction (48)
- Vibrio cholerae infection (48)
- Cell cycle (38)
- Proteasome (34)
- Chronic myeloid leukemia (31)
- Fc gamma R-mediated phagocytosis (31)
- SNARE interactions in vesicular transport (31)
- Oocyte meiosis (29)
- Progesterone-mediated oocyte maturation (29)
- Arachidonic acid metabolism (28)
- Ether lipid metabolism (27)
- Amino sugar and nucleotide sugar metabolism (24)
- Glycerophospholipid metabolism (24)
- Linoleic acid metabolism (24)
- alpha-Linolenic acid metabolism (24)
- Starch and sucrose metabolism (21)
- Histidine metabolism (19)
- beta-Alanine metabolism (17)
- Huntington's disease (11)
- Maturity onset diabetes of the young (11)
- Glycosaminoglycan degradation (9)
- Purine metabolism (9)
- Pyrimidine metabolism (9)
- Glycosphingolipid biosynthesis - lacto and neolacto series (7)
- Insulin signaling pathway (7)
- Leukocyte transendothelial migration (6)
- Pathogenic Escherichia coli infection (6)
- Tyrosine metabolism (6)
- Acute myeloid leukemia (4)
- Glutathione metabolism (4)
- Keratan sulfate biosynthesis (4)
- N-Glycan biosynthesis (4)
- Riboflavin metabolism (4)
- O-Glycan biosynthesis (3)
- Arginine and proline metabolism (2)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (2)
- Folate biosynthesis (2)
- Galactose metabolism (2)
- Glycosphingolipid biosynthesis - ganglio series (2)
- Glycosphingolipid biosynthesis - globo series (2)
- Lysosome (2)
- Tryptophan metabolism (2)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (1)
- Nitrogen metabolism (1)
- Other glycan degradation (1)