Germany
Japan
United Kingdom
China
Rabbit monoclonal anti-FOXO1 antibody for SISCAPA, clone OTIR3H6
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
Rabbit Polyclonal PPARGC1A Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PPARGC1A antibody was raised against a 19 amino acid peptide near the carboxy terminus of human PPARGC1A. The immunogen is located within the last 50 amino acids of PPARGC1A. |
Rabbit polyclonal anti-PGC-1alpha antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 766 of mouse PGC-1alpha |
Rabbit Polyclonal Anti-PPARGC1A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARGC1A antibody: synthetic peptide directed towards the N terminal of human PPARGC1A. Synthetic peptide located within the following region: MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDS |
Rabbit Polyclonal CrkII (Tyr221) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CrkII around the phosphorylation site of Tyrosine 221 |
| Modifications | Phospho-specific |
USD 275.00
3 Weeks
USD 345.00
In Stock
Rabbit polyclonal anti-KAP0 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human KAP0. |
Rabbit Polyclonal SREBP1 Antibody
| Applications | WB |
| Reactivities | Bovine, Hamster, Human, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a portion of the human SREBP1 protein sequence (between residues 700-800). [Uniprot# P36956] |
IKBKB Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human IKBKB |
Rabbit polyclonal FKHR (Phospho-Ser256) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human FKHR around the phosphorylation site of serine 256 (A-A-SP-M-D). |
| Modifications | Phospho-specific |
USD 475.00
5 Days
Rabbit Polyclonal Anti-PRKAR1A Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Prkar1a antibody is: synthetic peptide directed towards the N-terminal region of Rat Prkar1a. Synthetic peptide located within the following region: REYFERLEKEEARQIQSLQKSGIRTDSREDEISPPPPNPVVKGRRRRGAI |
Rabbit polyclonal anti-Elk1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Elk1. |
Anti-FOXO1 (Phospho-Ser319) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of serine 319 (T-S-S(p)-N-A) derived from Human FKHR/FOXO1A. |
| Modifications | Phospho-specific |
Rabbit Polyclonal CBL Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CBL |
Rabbit Polyclonal CBL (Tyr674) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CBL around the phosphorylation site of Tyrosine 674 |
| Modifications | Phospho-specific |
Rabbit Polyclonal CrkII Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CrkII |
Rabbit Polyclonal Elk1 (Ser389) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Elk1 around the phosphorylation site of Serine 389 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Elk1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Elk1 |
Rabbit Polyclonal Elk1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Elk1 |
Rabbit Polyclonal FKHR Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human FKHR |
Rabbit Polyclonal FOXO1/3/4-pan Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human FOXO1/3/4-pan |
Rabbit Polyclonal FOXO1A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human FOXO1A |
Rabbit Polyclonal FKHR (Ser256) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human FKHR around the phosphorylation site of Serine 256 |
| Modifications | Phospho-specific |
Rabbit Polyclonal FKHR (Ser319) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human FKHR around the phosphorylation site of Serine 319 |
| Modifications | Phospho-specific |
Rabbit Polyclonal FOXO1/3/4-pan (Thr24/32) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human FOXO1/3/4-pan around the phosphorylation site of Threonine 24/32 |
| Modifications | Phospho-specific |
Rabbit Polyclonal IKK-beta Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human IKK-beta |
Rabbit Polyclonal IKK- beta (Tyr188) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human IKK- beta around the phosphorylation site of Tyrosine 188 |
| Modifications | Phospho-specific |
Rabbit Polyclonal IKK- beta (Tyr199) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human IKK- beta around the phosphorylation site of Tyrosine 199 |
| Modifications | Phospho-specific |
Rabbit polyclonal FOXO1/3/4-pan (Phospho-Thr24/32) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human FOXO1/3/4-pan around the phosphorylation site of threonine 24/32 (S-C-TP-W-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal FOXO1/3/4-pan (Ab-24/32) antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human FOXO1/3/4-pan. |
Rabbit Polyclonal IKK-beta Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human IKK-beta |
Rabbit Polyclonal FKHR Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human FKHR |
Rabbit Polyclonal anti-PPARGC1A antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARGC1A antibody: synthetic peptide directed towards the N terminal of human PPARGC1A. Synthetic peptide located within the following region: PSFDALTDGDVTTDNEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQL |
Rabbit anti-FKHR (Phospho-Ser256) polyclonal antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanFKHR around the phosphorylation site of serine 256 (A-A-SP-M-D). |
| Modifications | Phospho-specific |
Rabbit anti-FKHR (Phospho-Ser319) polyclonal antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanFKHR around the phosphorylation site of serine 319 (T-S-SP-N-A). |
| Modifications | Phospho-specific |
USD 345.00
4 Weeks
Anti-PRKAR1A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to N terminal 250 amino acids of human protein kinase, cAMP-dependent, regulatory, type I, alpha |
Rabbit Polyclonal Elk1 (Ser383) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Elk1 around the phosphorylation site of Serine 383 |
| Modifications | Phospho-specific |
Rabbit anti-ELK1 (Phospho-Thr417) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanElk-1 around the phosphorylation site of threonine 417 (L-S-TP-P-V). |
| Modifications | Phospho-specific |
Rabbit Polyclonal FOXO1A (Ser329) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human FOXO1A around the phosphorylation site of Serine 329 |
| Modifications | Phospho-specific |
Phospho-IKBKB-Y199 Rabbit Polyclonal Antibody
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y199 of human IKBKB |
| Modifications | Phospho-specific |
Active filters
Reactivities
- Mouse
Families
- Transcription Factors
Pathways
- Insulin signaling pathway