Antibodies

View as table Download

Anti-HES1 mouse mAb, clone OTI4H1, DyLight488 conjugated

Applications FC
Reactivities Human
Conjugation DyLight 488

Anti-HES1 mouse mAb, clone OTI4H1, Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

Anti-HES1 mouse mAb, clone OTI4H1, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

Rabbit Polyclonal Anti-HNF1A Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF1A antibody: synthetic peptide directed towards the N terminal of human HNF1A. Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE

Rabbit polyclonal Neuro D (Ser274) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Neuro D around the phosphorylation site of serine 274 (P-L-SP-P-P).
Modifications Phospho-specific

Rabbit monoclonal antibody against HNF 3 Beta(clone EPR4466)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Nkx6.1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human Nkx6.1 protein (within residues 50-200). [Swiss-Prot P78426]

Rabbit anti-NR5A2 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NR5A2

Rabbit Monoclonal antibody against NR5A2

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-HNF4A Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 241-254 amino acids of human hepatocyte nuclear factor 4, alpha

Goat Polyclonal Anti-cardiac troponin T (aa201-213) Antibody

Applications WB
Reactivities Human, Mouse, Pig (Expected from sequence similarity: Feline, Rat, Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-cardiac troponin T (aa201-213) Antibody: Peptide with sequence C-TERKSGKRQTERE, from the internal region of the protein sequence according to NP_000355.2; NP_001001430.1; NP_001001431.1; NP_001001432.1.

Rabbit polyclonal antibody to HNF-1 alpha (HNF1 homeobox A)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 35 and 268 of HNF1 alpha (Uniprot ID#P20823)

Rabbit polyclonal NeuroD1 Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This NeuroD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 15-45 amino acids from the N-terminal region of human NeuroD1.

HNF 4 alpha (HNF4A) (2-15) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Bat, Canine, Equine, Hamster, Human, Monkey, Porcine, Rabbit
Immunogen Synthetic peptide from the N-terminus of human HNF4A / HNF4 (NP_849180.1; NP_000448.3; NP_849181.1)

Rabbit Polyclonal NKX2-2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen NKX2-2 antibody was raised against a 19 amino acid synthetic peptide near the center of human NKX2-2.

Rabbit polyclonal HNF4A Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen This HNF4A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 281-312 amino acids from the Central region of human HNF4A.

FOXA2 (453-463) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Bat, Bovine, Canine, Chicken, Equine, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Xenopus
Immunogen Synthetic peptide from C-terminus of human FOXA2

Goat Polyclonal Antibody against HNF4A

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence RLSKTLVDMDMADY-C, from the N Terminus of the protein sequence according to NP_849180.1; NP_000448.3; NP_849181.1.

Rabbit anti-HNF4A Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide of human HNF4A

Rabbit anti-PDX1 Polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human PDX1

Rabbit Polyclonal Anti-FOXA3 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXA3 antibody: synthetic peptide directed towards the middle region of human FOXA3. Synthetic peptide located within the following region: FENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSP

Rabbit Polyclonal Anti-HHEX Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HHEX antibody: synthetic peptide directed towards the C terminal of human HHEX. Synthetic peptide located within the following region: DQRQDLPSEQNKGASLDSSQCSPSPASQEDLESEISEDSDQEVDIEGDKS

Rabbit Polyclonal Anti-FOXA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXA2 antibody: synthetic peptide directed towards the N terminal of human FOXA2. Synthetic peptide located within the following region: MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAA

Rabbit Polyclonal Anti-FOXA2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FOXA2 antibody: synthetic peptide directed towards the C terminal of human FOXA2. Synthetic peptide located within the following region: QVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTSYYQGVYSRPIMNS

Rabbit Polyclonal Anti-Neuro D Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Neuro D Antibody: A synthesized peptide derived from human Neuro D

Rabbit Polyclonal Anti-HNF4alpha /gamma Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF4alpha /gamma Antibody: A synthesized peptide derived from human HNF4alpha /gamma

Rabbit Polyclonal Anti-HNF-1β(TCF-2) Antibody 

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF-1β(TCF-2) Antibody: Peptide sequence around aa.252~256(R-Q-K-N-P) derived from Human HNF-1b(TCF-2).

HES1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide.
Epitope: N-Terminus

PAX6 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen Recombinant protein from human PAX6

Goat Polyclonal Antibody against TCF2 / VHNF1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QAYDRQKNPSKEER, from the internal region of the protein sequence according to NP_000449.1; NP_006472.1.

Goat Polyclonal Antibody against FOXA2

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-GVYSRPIMNSS, from the C Terminus of the protein sequence according to NP_068556.1; NP_710141.1.

Anti-HNF1A Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 57-70 amino acids of human HNF1 homeobox A

Anti-FOXA2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 311-325 amino acids of Human forkhead box A2

Rabbit polyclonal FOXA2 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 128-157 amino acids from the Central region of human FOXA2.

Rabbit polyclonal FOXA2 Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen This FOXA2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 380-407 amino acids from the C-terminal region of human FOXA2.

Rabbit Polyclonal HNF4 alpha (Ser313) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human HNF4 alpha around the phosphorylation site of Serine 313
Modifications Phospho-specific

Rabbit Polyclonal anti-HHEX antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HHEX antibody: synthetic peptide directed towards the middle region of human HHEX. Synthetic peptide located within the following region: KQENPQSNKKEELESLDSSCDQRQDLPSEQNKGASLDSSQCSPSPASQED

Rabbit Polyclonal Anti-HNF4A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF4A antibody: synthetic peptide directed towards the middle region of human HNF4A. Synthetic peptide located within the following region: RGQAATPETPQPSPPGGSGSEPYKLLPGAVATIVKPLSAIPQPTITKQEV

Rabbit Polyclonal PDX-1/IPF1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human PDX1 protein (between residues 100-200) [UniProt P52945]

Rabbit Polyclonal Anti-HNF1A

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HNF1A antibody: synthetic peptide directed towards the N terminal of human HNF1A. Synthetic peptide located within the following region: HAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEE

NR5A2 mouse monoclonal antibody, clone 5E1, Purified

Applications IF, WB
Reactivities Human

HNF 4 alpha (HNF4A) (+ gamma) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 100-150 of Human HNF4α.

HNF 4 alpha (HNF4A) (N-term) rabbit polyclonal antibody, Purified

Applications IF, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 116~145 amino acids from the N-terminal region of human HNF4 alpha / TCF14

Goat Anti-PAX4 Antibody

Applications ELISA, WB
Reactivities Human, Mouse
Immunogen Peptide with sequence C-GKLATATSLPEDTVR, from the internal region of the protein sequence according to NP_006184.2.

Rabbit Polyclonal FOXA2 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen FOXA2 antibody was raised against a 16 amino acid peptide near the center of human FOXA2 .

Anti-HNF1A Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 64-78 amino acids of Human HNF1 homeobox A

Rabbit polyclonal IPF Antibody (C-term)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This IPF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from the C-terminal region of human IPF.

Rabbit polyclonal HNF1A Antibody (Center)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This HNF1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 177-205 amino acids from the Central region of human HNF1A.

Rabbit Polyclonal HNF4 alpha Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human HNF4 alpha