Germany
Japan
United Kingdom
China
Biotinylated Anti-Human IL-17E Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human IL-17E |
Antibodies
Download
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5H8
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E3
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-PD-L1 Antibody, clone OR-5E4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal SLC11A2 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SLC11A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 262-291 amino acids from the Central region of human SLC11A2. |
Rabbit Polyclonal Nephrin Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin. |
GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%). |
Rabbit Polyclonal Anti-EGFLAM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EGFLAM antibody is: synthetic peptide directed towards the C-terminal region of Human EGFLAM. Synthetic peptide located within the following region: TTAKDGLLLWRGDSPMRPNSDFISLGLRDGALVFSYNLGSGVASIMVNGS |
USD 375.00
2 Weeks
Rabbit Polyclonal Anti-G6PC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-G6PC antibody: synthetic peptide directed towards the N terminal of human G6PC. Synthetic peptide located within the following region: NLVFKWILFGQRPYWWVLDTDYYSNTSVPLIKQFPVTCETGPGSPSGHAM |
Rabbit Polyclonal Anti-CD81 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE |
Rabbit Polyclonal Antibody against XCT
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50). |
Rabbit Polyclonal STIM1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | STIM1 antibody was raised against a 24 amino acid synthetic peptide from near the carboxy terminus of human STIM1. The immunogen is located within the last 50 amino acids of STIM1. |
USD 380.00
2 Weeks
Rabbit monoclonal anti-ANK1 antibody for SISCAPA, clone OTIR3A12
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-HO-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HO-1 Antibody: A synthesized peptide derived from human HO-1 |
Rabbit Polyclonal Anti-MFN2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | MFN2 antibody was raised against a 17 amino acid peptide near the center of human MFN2. The immunogen is located within amino acids 250 - 300 of MFN2. |
Rabbit monoclonal anti-B3AT antibody for SISCAPA, clone OTIR5D8
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-RMD3 antibody for SISCAPA, clone OTIR1A2
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-AAAT antibody for SISCAPA, clone OTIR5A7
| Applications | SISCAPA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit monoclonal anti-CADH6 antibody for SISCAPA, clone OTIR5A6
| Applications | SISCAPA |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal HLA-G Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G. |
GRPR Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Dog, Gorilla, Horse, Human, Monkey, Pig, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | GRPR antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human GRPR. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Horse, Rabbit, Pig (100%); Bovine (94%); Mouse, Rat, Hamster (83%). |
B1R / BDKRB1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Horse (81%). |
Rabbit Polyclonal Anti-ATP6V0A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP6V0A2 antibody: synthetic peptide directed towards the N terminal of human ATP6V0A2. Synthetic peptide located within the following region: INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN |
Active filters
Isotypes
- IgG
Families
- Transmembrane
Filter by
Target Symbol
- EGFR (51)
- BCL2 (23)
- ERBB2 (21)
- KDR (21)
- APP (20)
- BAX (18)
- BCL2L1 (16)
- CSF1R (16)
- CD44 (15)
- CDH1 (15)
- IGF1R (15)
- MET (15)
- GJA1 (14)
- KIT (14)
- PDGFRB (14)
- CAV1 (12)
- ERBB3 (12)
- FGFR1 (12)
- GRIN1 (12)
- ADRA1B (11)
- CLDN7 (11)
- GRIN2B (11)
- ICAM1 (11)
- ITGB3 (11)
- MUC1 (11)
- NTRK2 (11)
- PECAM1 (11)
- TNFSF11 (11)
- AIFM1 (10)
- BDNF (10)
- CD274 (10)
- CYP1A1 (10)
- EPHA2 (10)
- EPOR (10)
- MCL1 (10)
- NOTCH2 (10)
- NRG1 (10)
- PTGS1 (10)
- TNF (10)
- ADRB2 (9)
- CCR5 (9)
- CD70 (9)
- CDH5 (9)
- CLDN1 (9)
- CYP2D6 (9)
- CYP2E1 (9)
- F2R (9)
- FGF4 (9)
- FGFR2 (9)
- GRIA2 (9)
- GRM3 (9)
- HCRTR1 (9)
- MIA2 (9)
- NGFR (9)
- P2RX2 (9)
- SOX1 (9)
- TGFBR2 (9)
- TNFRSF1B (9)
- ACE2 (8)
- ADAM15 (8)
- AGER (8)
- CANX (8)
- CD22 (8)
- CD40 (8)
- CLDN11 (8)
- CLDN5 (8)
- CUX1 (8)
- CXCR4 (8)
- CYP3A4 (8)
- EDA (8)
- EGF (8)
- F10 (8)
- FASLG (8)
- HSD17B13 (8)
- ITGAV (8)
- KITLG (8)
- MERTK (8)
- MME (8)
- NTRK1 (8)
- ORAI1 (8)
- SLC1A4 (8)
- STEAP4 (8)
- TGFBR1 (8)
- TNFSF10 (8)
- TNFSF13 (8)
- TRPC6 (8)
- ABCD4 (7)
- ADAM17 (7)
- ADRA2A (7)
- ANTXR1 (7)
- BAK1 (7)
- BCAP31 (7)
- CAV2 (7)
- CCKAR (7)
- CD247 (7)
- CLDN3 (7)
- CLDN4 (7)
- CX3CR1 (7)
- DIABLO (7)
- DLL4 (7)
Reactivities
- Human (8069)
- Mouse (3557)
- Rat (2830)
- Dog (217)
- Monkey (192)
- Bovine (162)
- Pig (132)
- Gorilla (126)
- Gibbon (94)
- Rabbit (86)
- Cow (84)
- Hamster (69)
- Horse (68)
- Bat (57)
- Chicken (38)
- Chimpanzee (38)
- Canine (32)
- Rhesus Monkey (29)
- Orang-Utan (27)
- Zebrafish (23)
- Xenopus (22)
- Guinea Pig (17)
- Primate (13)
- X. tropicalis (9)
- Macaque (7)
- Sheep (6)
- Feline (4)
- Equine (2)
- Fish (2)
- Opossum (2)
- Porcine (2)
- Canis (1)
- Goat (1)
- Murine (1)
- Pufferfish (1)
Applications
Antibody Hosts
Clonalities
Conjugates
Modifications
Assay Types
Assay Platforms
Pathways
- Neuroactive ligand-receptor interaction (789)
- Cytokine-cytokine receptor interaction (720)
- Metabolic pathways (518)
- Pathways in cancer (505)
- Calcium signaling pathway (418)
- Cell adhesion molecules (CAMs) (386)
- Olfactory transduction (342)
- Endocytosis (299)
- Focal adhesion (274)
- Hematopoietic cell lineage (274)
- MAPK signaling pathway (253)
- Regulation of actin cytoskeleton (234)
- Colorectal cancer (224)
- Adherens junction (186)
- Leukocyte transendothelial migration (178)
- Alzheimer's disease (175)
- Prostate cancer (171)
- Melanoma (156)
- Jak-STAT signaling pathway (155)
- Gap junction (153)
- Axon guidance (152)
- Melanogenesis (148)
- Apoptosis (139)
- Chemokine signaling pathway (139)
- Pancreatic cancer (138)
- Amyotrophic lateral sclerosis (ALS) (136)
- Natural killer cell mediated cytotoxicity (136)
- Dilated cardiomyopathy (131)
- ErbB signaling pathway (127)
- ABC transporters (115)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (113)
- ECM-receptor interaction (113)
- Epithelial cell signaling in Helicobacter pylori infection (112)
- Hypertrophic cardiomyopathy (HCM) (111)
- Toll-like receptor signaling pathway (109)
- Bladder cancer (106)
- Wnt signaling pathway (106)
- Basal cell carcinoma (101)
- Glioma (101)
- Huntington's disease (99)
- Neurotrophin signaling pathway (98)
- Vascular smooth muscle contraction (96)
- Endometrial cancer (95)
- GnRH signaling pathway (91)
- Tight junction (91)
- Drug metabolism - cytochrome P450 (86)
- Non-small cell lung cancer (86)
- Viral myocarditis (85)
- Retinol metabolism (84)
- Adipocytokine signaling pathway (79)
- Lysosome (78)
- Antigen processing and presentation (76)
- Systemic lupus erythematosus (74)
- TGF-beta signaling pathway (72)
- Metabolism of xenobiotics by cytochrome P450 (71)
- Long-term potentiation (68)
- Parkinson's disease (66)
- Small cell lung cancer (66)
- Graft-versus-host disease (64)
- Hedgehog signaling pathway (63)
- Dorso-ventral axis formation (61)
- Allograft rejection (60)
- Primary immunodeficiency (59)
- Autoimmune thyroid disease (57)
- PPAR signaling pathway (57)
- Long-term depression (56)
- Drug metabolism - other enzymes (54)
- Asthma (53)
- Notch signaling pathway (53)
- Chronic myeloid leukemia (52)
- Oxidative phosphorylation (52)
- Purine metabolism (52)
- T cell receptor signaling pathway (52)
- Type I diabetes mellitus (51)
- Cardiac muscle contraction (50)
- N-Glycan biosynthesis (48)
- Taste transduction (48)
- p53 signaling pathway (48)
- Arachidonic acid metabolism (47)
- Complement and coagulation cascades (46)
- Pathogenic Escherichia coli infection (46)
- Androgen and estrogen metabolism (45)
- SNARE interactions in vesicular transport (44)
- Renin-angiotensin system (42)
- Renal cell carcinoma (41)
- Sphingolipid metabolism (41)
- Starch and sucrose metabolism (41)
- Glycerophospholipid metabolism (39)
- Progesterone-mediated oocyte maturation (39)
- Type II diabetes mellitus (37)
- Linoleic acid metabolism (36)
- Oocyte meiosis (36)
- B cell receptor signaling pathway (35)
- Prion diseases (35)
- Vibrio cholerae infection (35)
- Glycerolipid metabolism (34)
- Porphyrin and chlorophyll metabolism (34)
- RIG-I-like receptor signaling pathway (33)
- Fatty acid metabolism (32)
- Tyrosine metabolism (29)
- Fc gamma R-mediated phagocytosis (28)
- Insulin signaling pathway (28)
- O-Glycan biosynthesis (28)
- Tryptophan metabolism (28)
- Ascorbate and aldarate metabolism (27)
- Thyroid cancer (26)
- Chondroitin sulfate biosynthesis (25)
- Cytosolic DNA-sensing pathway (25)
- Glycosphingolipid biosynthesis - lacto and neolacto series (25)
- Ether lipid metabolism (24)
- Fc epsilon RI signaling pathway (24)
- VEGF signaling pathway (24)
- Acute myeloid leukemia (23)
- Heparan sulfate biosynthesis (23)
- NOD-like receptor signaling pathway (23)
- Pentose and glucuronate interconversions (23)
- Pyrimidine metabolism (23)
- Riboflavin metabolism (23)
- Glutathione metabolism (22)
- Keratan sulfate biosynthesis (21)
- Biosynthesis of unsaturated fatty acids (20)
- Caffeine metabolism (19)
- Nicotinate and nicotinamide metabolism (18)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (16)
- Primary bile acid biosynthesis (16)
- Glycosphingolipid biosynthesis - ganglio series (15)
- Glycolysis / Gluconeogenesis (14)
- Galactose metabolism (13)
- Steroid biosynthesis (12)
- C21-Steroid hormone metabolism (11)
- Glycosphingolipid biosynthesis - globo series (11)
- Arginine and proline metabolism (10)
- Histidine metabolism (10)
- Nitrogen metabolism (10)
- Propanoate metabolism (10)
- Ubiquitin mediated proteolysis (10)
- Valine (10)
- leucine and isoleucine degradation (10)
- Cell cycle (9)
- Glycine (9)
- beta-Alanine metabolism (9)
- serine and threonine metabolism (9)
- Glycosaminoglycan degradation (8)
- Lysine degradation (8)
- Phenylalanine metabolism (8)
- Limonene and pinene degradation (7)
- Phosphatidylinositol signaling system (7)
- Butanoate metabolism (6)
- Cyanoamino acid metabolism (6)
- Pantothenate and CoA biosynthesis (6)
- Pyruvate metabolism (6)
- Selenoamino acid metabolism (6)
- Taurine and hypotaurine metabolism (6)
- Amino sugar and nucleotide sugar metabolism (5)
- Base excision repair (5)
- Inositol phosphate metabolism (5)
- Sulfur metabolism (5)
- O-Mannosyl glycan biosynthesis (4)
- alpha-Linolenic acid metabolism (4)
- Maturity onset diabetes of the young (2)
- Other glycan degradation (2)
- Terpenoid backbone biosynthesis (2)
- Protein export (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)