Germany
Japan
United Kingdom
China
Anti-MNAT1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Antibodies
View as table Download
Rabbit polyclonal CUL4B Antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CUL4B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 250-278 amino acids from the Central region of human CUL4B. |
Rabbit polyclonal POLD2 Antibody (Center)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | This POLD2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 237-265 amino acids from the Central region of human POLD2. |
Rabbit Polyclonal anti-CCNH antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCNH antibody: synthetic peptide directed towards the N terminal of human CCNH. Synthetic peptide located within the following region: PHEEMTLCKYYEKRLLEFCSVFKPAMPRSVVGTACMYFKRFYLNNSVMEY |
Rabbit Polyclonal anti-CDK7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CDK7 antibody is: synthetic peptide directed towards the N-terminal region of Human CDK7. Synthetic peptide located within the following region: VKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDG |
Rabbit Polyclonal anti-GTF2H3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GTF2H3 antibody is: synthetic peptide directed towards the middle region of Human GTF2H3. Synthetic peptide located within the following region: KGQHTETLLAGSLAKALCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQY |
Rabbit Polyclonal Anti-GTF2H4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2H4 antibody: synthetic peptide directed towards the N terminal of human GTF2H4. Synthetic peptide located within the following region: ALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIA |
Rabbit Polyclonal Anti-ERCC8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the N terminal of human ERCC8. Synthetic peptide located within the following region: DVERIHGGGINTLDIEPVEGRYMLSGGSDGVIVLYDLENSSRQSYYTCKA |
Rabbit Polyclonal Anti-ERCC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC2 antibody: synthetic peptide directed towards the N terminal of human ERCC2. Synthetic peptide located within the following region: KLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTVS |
Rabbit Polyclonal Anti-GTF2H2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2H2 antibody: synthetic peptide directed towards the N terminal of human GTF2H2. Synthetic peptide located within the following region: DILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKPNRLTCTL |
Rabbit Polyclonal Anti-GTF2H2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2H2 antibody: synthetic peptide directed towards the middle region of human GTF2H2. Synthetic peptide located within the following region: HHLFPLDAFQEIPLEEYNGERFCYGCQGELKDQHVYVCAVCQNVFCVDCD |
Rabbit Polyclonal Anti-GTF2H1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2H1 antibody: synthetic peptide directed towards the middle region of human GTF2H1. Synthetic peptide located within the following region: ERFQVTKLCPFQEKIRRQYLSTNLVSHIEEMLQTAYNKLHTWQSRRLMKK |
Rabbit Polyclonal Anti-CCNH Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCNH antibody: synthetic peptide directed towards the middle region of human CCNH. Synthetic peptide located within the following region: KQKLERCHSAELALNVITKKRKGYEDDDYVSKKSKHEEEEWTDDDLVESL |
Rabbit Polyclonal Anti-MNAT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MNAT1 antibody: synthetic peptide directed towards the N terminal of human MNAT1. Synthetic peptide located within the following region: DDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGT |
Rabbit Polyclonal Anti-CDK7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CDK7 antibody: synthetic peptide directed towards the middle region of human CDK7. Synthetic peptide located within the following region: TQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALE |
Rabbit Polyclonal Anti-GTF2H4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2H4 antibody: synthetic peptide directed towards the N terminal of human GTF2H4. Synthetic peptide located within the following region: ESTPSRGLNRVHLQCRNLQEFLGGLSPGVLDRLYGHPATCLAVFRELPSL |
Rabbit Polyclonal Anti-POLE3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-POLE3 Antibody: synthetic peptide directed towards the N terminal of human POLE3. Synthetic peptide located within the following region: MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATS |
Rabbit Polyclonal Anti-RPA4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPA4 antibody: synthetic peptide directed towards the middle region of human RPA4. Synthetic peptide located within the following region: VPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCD |
Rabbit Polyclonal Anti-RPA4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPA4 antibody: synthetic peptide directed towards the C terminal of human RPA4. Synthetic peptide located within the following region: HQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD |
Rabbit Polyclonal Anti-ERCC3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC3 antibody: synthetic peptide directed towards the N terminal of human ERCC3. Synthetic peptide located within the following region: MGKRDRADRDKKKSRKRHYEDEEDDEEDAPGNDPQEAVPSAAGKQVDESG |
Rabbit Polyclonal Anti-ERCC6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERCC6 antibody is: synthetic peptide directed towards the C-terminal region of Human ERCC6. Synthetic peptide located within the following region: EASALLPTTEHDDLLVEMRNFIAFQAHTDGQASTREILQEFESKLSASQS |
Rabbit Polyclonal Anti-GTF2H4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2H4 antibody: synthetic peptide directed towards the N terminal of human GTF2H4. Synthetic peptide located within the following region: MESTPSRGLNRVHLQCRNLQEFLGGLSPGVLDRLYGHPATCLAVFRELPS |
Rabbit Polyclonal Anti-GTF2H4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GTF2H4 antibody: synthetic peptide directed towards the C terminal of human GTF2H4. Synthetic peptide located within the following region: LSQVDFELLLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS |
Rabbit Polyclonal Anti-MNAT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MNAT1 Antibody: synthetic peptide directed towards the C terminal of human MNAT1. Synthetic peptide located within the following region: LQIETYGPHVPELEMLGRLGYLNHVRAASPQDLAGGYTSSLACHRALQDA |
Rabbit Polyclonal Anti-LIG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LIG1 Antibody: synthetic peptide directed towards the middle region of human LIG1. Synthetic peptide located within the following region: ALEGGEVKIFSRNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDR |
Rabbit Polyclonal Anti-LIG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LIG1 Antibody: synthetic peptide directed towards the middle region of human LIG1. Synthetic peptide located within the following region: PSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAF |
Rabbit Polyclonal Anti-ERCC5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ERCC5 Antibody: synthetic peptide directed towards the N terminal of human ERCC5. Synthetic peptide located within the following region: NPQAIDIESEDFSSLPPEVKHEILTDMKEFTKRRRTLFEAMPEESDDFSQ |
Rabbit Polyclonal Anti-ERCC5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ERCC5 Antibody is: synthetic peptide directed towards the N-terminal region of Human ERCC5. Synthetic peptide located within the following region: HSGHIRRQYEDEGGFLKEVESRRVVSEDTSHYILIKGIQAKTVAEVDSES |
Rabbit Polyclonal Anti-RFC3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RFC3 antibody: synthetic peptide directed towards the C terminal of human RFC3. Synthetic peptide located within the following region: IIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKF |
Rabbit Polyclonal Anti-RFC3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RFC3 antibody: synthetic peptide directed towards the N terminal of human RFC3. Synthetic peptide located within the following region: YHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKL |
Rabbit Polyclonal Anti-RFC4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RFC4 antibody: synthetic peptide directed towards the middle region of human RFC4. Synthetic peptide located within the following region: DKLEAVVKDLIDEGHAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDK |
Rabbit Polyclonal Anti-Gtf2h2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Gtf2h2 antibody is: synthetic peptide directed towards the N-terminal region of MOUSE Gtf2h2. Synthetic peptide located within the following region: SLKATIEDILFKAKRKRVFEHHGQVRLGMMRHLYVVVDGSRTMEDQDLKP |
Rabbit polyclonal Anti-Rfc1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Rfc1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Rfc1. Synthetic peptide located within the following region: SPTKRESVSPEDSEKKRTNYQAYRSYLNREGPKALGSKEIPKGAENCLEG |
Rabbit polyclonal Anti-RFC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RFC1 antibody: synthetic peptide directed towards the middle region of human RFC1. Synthetic peptide located within the following region: AQAIYASVLPGELMRGYMTQFPTFPSWLGKHSSTGKHDRIVQDLALHMSL |
Rabbit polyclonal Anti-RPA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPA1 antibody: synthetic peptide directed towards the middle region of human RPA1. Synthetic peptide located within the following region: SRGEGKLFSLELVDESGEIRATAFNEQVDKFFPLIEVNKVYYFSKGTLKI |
Rabbit polyclonal Anti-RPA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RPA1 antibody: synthetic peptide directed towards the middle region of human RPA1. Synthetic peptide located within the following region: TLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEA |
Rabbit polyclonal anti-Xeroderma Pigmentosum Group C (XPC) antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Xeroderma Pigmentosum Group C (XPC) |
Rabbit anti PCNA Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-CUL4A Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 720-734 amino acids of Human cullin 4A |
Anti-PCNA Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 9-252 amino acids of Human Proliferating cell nuclear antigen |
Anti-DDB1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1125-1140 amino acids of Human DNA damage-binding protein 1 |
Rabbit Polyclonal Anti-RPA2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-CUL4B Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CUL4B |
Active filters
Isotypes
- IgG
Pathways
- Nucleotide excision repair
Filter by
Category
Target Symbol
- PCNA (10)
- CDK7 (9)
- RPA2 (9)
- ERCC8 (8)
- CCNH (7)
- DDB1 (6)
- GTF2H2 (6)
- CUL4B (5)
- LIG1 (5)
- MNAT1 (5)
- RPA1 (5)
- XPA (5)
- ERCC1 (4)
- ERCC3 (4)
- ERCC5 (4)
- GTF2H4 (4)
- RAD23A (4)
- RFC2 (4)
- RFC3 (4)
- RFC4 (4)
- XPC (4)
- CUL4A (3)
- ERCC4 (3)
- ERCC6 (3)
- GTF2H1 (3)
- POLD1 (3)
- POLE3 (3)
- RFC1 (3)
- DDB2 (2)
- ERCC2 (2)
- GTF2H3 (2)
- POLD2 (2)
- POLE4 (2)
- RPA4 (2)
- CETN2 (1)
- POLD3 (1)
- POLE (1)
- RAD23B (1)
- RBX1 (1)
- RFC5 (1)
- RPA3 (1)