Germany
Japan
United Kingdom
China
IL2 mouse monoclonal antibody, clone 6B1, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Antibodies
View as table DownloadTNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Biotin
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Biotin |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, HRP
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | HRP |
Goat Anti-FAS / CD95 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KTCRKHRKENQGSH, from the internal region of the protein sequence according to NP_000034.1; NP_690610.1; NP_690611.1. |
Rabbit polyclonal antibody to Perforin 1 (perforin 1 (pore forming protein))
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 9 and 214 of Perforin 1 (Uniprot ID#P14222) |
Rabbit polyclonal antibody to HLA-DRB1 (major histocompatibility complex, class II, DR beta 1)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 56 and 250 of HLA-DRB1 (Uniprot ID#P01912) |
Rabbit polyclonal antibody to HLA-DRB3 (major histocompatibility complex, class II, DR beta 3)
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 4 and 266 of HLA-DRB3 (Uniprot ID#P79483) |
Rabbit polyclonal antibody to HLA-DRB4 (major histocompatibility complex, class II, DR beta 4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 266 of HLA DR beta (Uniprot ID#P13762) |
Goat Anti-HLA-DQA2 & HLA-DQA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QGLRSVGASRH, from the C Terminus of the protein sequence according to NP_064440.1; NP_002113.2. |
Rabbit polyclonal anti-CD40 antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Pig |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to residues surrounding amino acids 261 of human CD40 |
Rabbit polyclonal IL-2 antibody Peroxidase Conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-2 protein. |
Rabbit polyclonal anti-IL-4 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein. |
Rabbit polyclonal IL-4 antibody Peroxidase Conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein. |
Rabbit polyclonal IL-4 antibody Biotin Conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein. |
Rabbit polyclonal anti-IL-10 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The whole rabbit serum was prepared by repeated immunizations with human IL-10. |
Mouse Anti-Human CD28 Purified (100 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Anti-Human CD154 (CD40 Ligand) Purified (25 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Anti-Human CD80 (B7-1) Purified (100 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Anti-Human CD178 (CD95 Ligand) Purified (25 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Anti-Human TNF alpha Purified (50 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal HLA-DQB1 Antibody (N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HLA-DQB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-39 amino acids from the N-terminal region of human HLA-DQB1. |
Anti-Human sFas Ligand Goat Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CHO cell derived recombinant Human sFas Ligand. |
Rabbit polyclonal Anti-HLA-F Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HLA-F antibody: synthetic peptide directed towards the N terminal of human HLA-F. Synthetic peptide located within the following region: PWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMN |
Rabbit polyclonal Anti-HLA-DQA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HLA-DQA2 antibody: synthetic peptide directed towards the N terminal of human HLA-DQA2. Synthetic peptide located within the following region: GVNFYQSHGPSGQYTHEFDGDEEFYVDLETKETVWQLPMFSKFISFDPQS |
Rabbit polyclonal Anti-HLA-DQA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HLA-DQA2 antibody: synthetic peptide directed towards the middle region of human HLA-DQA2. Synthetic peptide located within the following region: LPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSK |
Rabbit Polyclonal Anti-IL5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IL5 Antibody: synthetic peptide directed towards the middle region of human IL5. Synthetic peptide located within the following region: LESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFL |
Rabbit Polyclonal Anti-IL4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IL4 Antibody: synthetic peptide directed towards the middle region of human IL4. Synthetic peptide located within the following region: TVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSC |
Rabbit Polyclonal Anti-IL4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IL4 Antibody: synthetic peptide directed towards the middle region of human IL4. Synthetic peptide located within the following region: LIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCS |
Rabbit Polyclonal Anti-FAIM2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAIM2 antibody is: synthetic peptide directed towards the N-terminal region of Human FAIM2. Synthetic peptide located within the following region: QVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVD |
Rabbit Polyclonal Anti-HLA-DPA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HLA-DPA1 antibody: synthetic peptide directed towards the middle region of human HLA-DPA1. Synthetic peptide located within the following region: EAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGT |
Rabbit Polyclonal Anti-HLA-DOB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HLA-DOB antibody is: synthetic peptide directed towards the N-terminal region of Human HLA-DOB. Synthetic peptide located within the following region: LTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNLEEYVR |
Mouse Monoclonal FAS (C-terminus) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-IFN-gamma Antibody, Biotin conjugated
| Reactivities | Human, Rhesus Macaque |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-IFN-gamma Antibody, FITC conjugated
| Reactivities | Human, Rhesus Macaque |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-IFN-gamma Antibody
| Reactivities | Human, Rhesus Macaque |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-IL-4 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-IL-5 Antibody
| Reactivities | Human, Rhesus Macaque |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-IL-5 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-IL-10 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Reactivities
- Human
Pathways
- Allograft rejection
Filter by
Category
Target Symbol
- CD40 (118)
- CD80 (102)
- CD86 (58)
- TNF (53)
- IFNG (34)
- CD28 (28)
- IL2 (26)
- HLA-A (18)
- IL12A (18)
- IL12B (18)
- SMURF2 (17)
- GZMB (16)
- IL4 (16)
- FAS (14)
- IL10 (14)
- HLA-DQA2 (13)
- PRF1 (13)
- FASLG (8)
- IL5 (7)
- CD40LG (6)
- HLA-DRB5 (5)
- HLA-G (5)
- HLA-B (3)
- HLA-DRA (3)
- HLA-DRB3 (3)
- HLA-E (3)
- HLA-DMB (2)
- HLA-DOB (2)
- HLA-DPA1 (2)
- HLA-DPB1 (2)
- HLA-F (2)
- HLA-C (1)
- HLA-DOA (1)
- HLA-DQB1 (1)
- HLA-DRB1 (1)
- HLA-DRB4 (1)