IL2 mouse monoclonal antibody, clone 6B1, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
IL2 mouse monoclonal antibody, clone 6B1, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, Biotin
Applications | ELISA |
Reactivities | Human |
Conjugation | Biotin |
TNF alpha (TNF) mouse monoclonal antibody, clone B1E4, HRP
Applications | ELISA |
Reactivities | Human |
Conjugation | HRP |
Goat Anti-FAS / CD95 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence KTCRKHRKENQGSH, from the internal region of the protein sequence according to NP_000034.1; NP_690610.1; NP_690611.1. |
Rabbit polyclonal antibody to Perforin 1 (perforin 1 (pore forming protein))
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 9 and 214 of Perforin 1 (Uniprot ID#P14222) |
Rabbit polyclonal antibody to HLA-DRB1 (major histocompatibility complex, class II, DR beta 1)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 56 and 250 of HLA-DRB1 (Uniprot ID#P01912) |
Rabbit polyclonal antibody to HLA-DRB3 (major histocompatibility complex, class II, DR beta 3)
Applications | IF |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 4 and 266 of HLA-DRB3 (Uniprot ID#P79483) |
Rabbit polyclonal antibody to HLA-DRB4 (major histocompatibility complex, class II, DR beta 4)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 266 of HLA DR beta (Uniprot ID#P13762) |
Goat Anti-HLA-DQA2 & HLA-DQA1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-QGLRSVGASRH, from the C Terminus of the protein sequence according to NP_064440.1; NP_002113.2. |
Rabbit polyclonal anti-CD40 antibody
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Pig |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to residues surrounding amino acids 261 of human CD40 |
Rabbit polyclonal IL-2 antibody Peroxidase Conjugated
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-2 protein. |
Rabbit polyclonal anti-IL-4 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein. |
Rabbit polyclonal IL-4 antibody Peroxidase Conjugated
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein. |
Rabbit polyclonal IL-4 antibody Biotin Conjugated
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This purified antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-4 protein. |
Rabbit polyclonal anti-IL-10 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The whole rabbit serum was prepared by repeated immunizations with human IL-10. |
Mouse Anti-Human CD28 Purified (100 ug)
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Anti-Human CD154 (CD40 Ligand) Purified (25 ug)
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Anti-Human CD80 (B7-1) Purified (100 ug)
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Anti-Human CD178 (CD95 Ligand) Purified (25 ug)
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Anti-Human TNF alpha Purified (50 ug)
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal HLA-DQB1 Antibody (N-term)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This HLA-DQB1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-39 amino acids from the N-terminal region of human HLA-DQB1. |
Biotinylated Anti-Human IL-2 Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-2 |
Biotinylated Anti-Human IL-2 Goat Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-2 |
Biotinylated Anti-Human IL-4 Goat Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-4 |
Biotinylated Anti-Human IL-5 Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-5 |
Biotinylated Anti-Human IL-10 Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IL-10 |
Biotinylated Anti-Human IL-12 Goat Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CHO cells derived Recombinant Human IL-12 |
Anti-Human sFas Ligand Goat Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CHO cell derived recombinant Human sFas Ligand. |
Biotinylated Anti-Human IFN-? Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IFN-γ |
Biotinylated Anti-Human TNF-a Goat Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human TNF-α |
Biotinylated Anti-Human TNF-a Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human TNF-α |
Rabbit polyclonal Anti-HLA-F Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HLA-F antibody: synthetic peptide directed towards the N terminal of human HLA-F. Synthetic peptide located within the following region: PWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMN |
Rabbit polyclonal Anti-HLA-DQA2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HLA-DQA2 antibody: synthetic peptide directed towards the N terminal of human HLA-DQA2. Synthetic peptide located within the following region: GVNFYQSHGPSGQYTHEFDGDEEFYVDLETKETVWQLPMFSKFISFDPQS |
Rabbit polyclonal Anti-HLA-DQA2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HLA-DQA2 antibody: synthetic peptide directed towards the middle region of human HLA-DQA2. Synthetic peptide located within the following region: LPMFSKFISFDPQSALRNMAVGKHTLEFMMRQSNSTAATNEVPEVTVFSK |
Rabbit Polyclonal Anti-IL5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-IL5 Antibody: synthetic peptide directed towards the middle region of human IL5. Synthetic peptide located within the following region: LESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFL |
Rabbit Polyclonal Anti-IL4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-IL4 Antibody: synthetic peptide directed towards the middle region of human IL4. Synthetic peptide located within the following region: TVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSC |
Rabbit Polyclonal Anti-IL4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-IL4 Antibody: synthetic peptide directed towards the middle region of human IL4. Synthetic peptide located within the following region: LIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCS |
Rabbit Polyclonal Anti-FAIM2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FAIM2 antibody is: synthetic peptide directed towards the N-terminal region of Human FAIM2. Synthetic peptide located within the following region: QVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVD |
Rabbit Polyclonal Anti-HLA-DPA1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HLA-DPA1 antibody: synthetic peptide directed towards the middle region of human HLA-DPA1. Synthetic peptide located within the following region: EAQEPIQMPETTETVLCALGLVLGLVGIIVGTVLIIKSLRSGHDPRAQGT |
Rabbit Polyclonal Anti-HLA-DOB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HLA-DOB antibody is: synthetic peptide directed towards the N-terminal region of Human HLA-DOB. Synthetic peptide located within the following region: LTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNLEEYVR |
Mouse Monoclonal FAS (C-terminus) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-IFN-gamma Antibody, Biotin conjugated
Reactivities | Human, Rhesus Macaque |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-IFN-gamma Antibody, FITC conjugated
Reactivities | Human, Rhesus Macaque |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-IFN-gamma Antibody
Reactivities | Human, Rhesus Macaque |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-IL-4 Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-IL-5 Antibody
Reactivities | Human, Rhesus Macaque |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-IL-5 Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-IL-10 Antibody
Reactivities | Human |
Conjugation | Unconjugated |