B7-2 (CD86) mouse monoclonal antibody, clone B-T7, Azide Free
Applications | FC, FN |
Reactivities | Human |
B7-2 (CD86) mouse monoclonal antibody, clone B-T7, Azide Free
Applications | FC, FN |
Reactivities | Human |
TSH beta (TSHB) (intact) mouse monoclonal antibody, clone B31, Purified
Applications | ELISA, Labeling |
Reactivities | Human |
CTLA4 mouse monoclonal antibody, clone A3.4H2.H12, FITC
Applications | FC |
Reactivities | Human |
Conjugation | FITC |
IL10 mouse monoclonal antibody, clone BN-10, PE
Applications | FC, IHC |
Reactivities | Human |
Conjugation | PE |
CD95 (FAS) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 280-330 of Human CD95. |
SMURF 2 (SMURF2) (N-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of human SMURF2. |
HLA-DRA (C-term) rabbit polyclonal antibody
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 149-177 amino acids from the C-terminal region of human HLA-DRA. |
IL2 rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between aa 57-86 from the Center region of Human IL2 |
CD40L (CD40LG) (C-term) rabbit polyclonal antibody
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human TRAP |
Fas Ligand (FASLG) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | FASLG antibody was raised against peptide mapping near the amino terminus of rat FAS-L |
Fas Ligand (FASLG) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to a sequence mapping at the C-terminal of human FAS-L |
HLA-DRB5 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 43~70 amino acids from the Central region of human HLA class II DRB5 beta / HLA-DRB5 |
IL2 mouse monoclonal antibody, clone 4F12, Azide Free
Applications | ELISA, FN |
Reactivities | Birds, Chicken, Mammalian |
HLAG (HLA-G) mouse monoclonal antibody, clone MEM-G/1, Biotin
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
Rabbit Polyclonal antibody to interferon alpha 8 (interferon, alpha 8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 189 of interferon alpha 8 (Uniprot ID#P32881) |
Rabbit polyclonal antibody to HLA-DMA (major histocompatibility complex, class II, DM alpha)
Applications | IHC, WB |
Reactivities | Human |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 52 and 245 of HLA-DMA |
Goat Polyclonal Antibody against thyroid peroxidase
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-TRHVIQVSNEVVTDD, from the internal region of the protein sequence according to NP_000538.3; NP_783650.1; NP_783652.1; NP_783653.1. |
Goat Anti-TSHR (aa101-115) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SKVTHIEIRNTRNLT, from the internal region of the protein sequence according to NP_000360.2; NP_001018046.1. |
Goat Anti-CD28 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence SQQLQVYSKTGFNCD, from the internal region of the protein sequence according to NP_006130.1. |
Rabbit polyclonal anti-IL-2 antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | E. coli expressed human IL-2 |
Rabbit polyclonal anti-IL-4 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E. coli expressed recombinant human IL-4 |
Mouse Anti-Human HLA-E Purified (25 ug)
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Anti-Human IL-4 Purified (50 ug)
Reactivities | Human |
Conjugation | Unconjugated |
Mouse monoclonal HLA-G Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TSHR Antibody (C-Terminus)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | TSH Receptor / TSHR antibody was raised against synthetic 19 amino acid peptide from C-terminus of human TSH Receptor. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Bat, Dog, Elephant, Horse, Pig, Guinea pig (94%); Mouse, Rat, Sheep, Cat, Bovine, Hamster, Panda, Rabbit, Opossum (89%). |
Rabbit Polyclonal Anti-HLA-A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HLA-A antibody is: synthetic peptide directed towards the N-terminal region of Human HLA-A. Synthetic peptide located within the following region: SDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQ |
Mouse anti TSH Monoclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-CD80 Antibody [7A2]
Applications | IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
purified CD80 Capture mouse monoclonal antibody, Luminex validated, clone OTI2E5
Applications | LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700489 |
Thyroid Peroxidase (TPO) mouse monoclonal antibody, clone TPO35
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
IL2 mouse monoclonal antibody, clone 5A8, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
IL2 mouse monoclonal antibody, clone 9F9, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
IL2 mouse monoclonal antibody, clone 10C4, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
IL2 mouse monoclonal antibody, clone 8C2, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
IL2 mouse monoclonal antibody, clone 6F11, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
IL2 mouse monoclonal antibody, clone 6B1, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
hCG (CGA) mouse monoclonal antibody, clone FSH-1, Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
hCG (CGA) mouse monoclonal antibody, clone HCG-1, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
hCG (CGA) mouse monoclonal antibody, clone TSH-1, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
CD28 mouse monoclonal antibody, clone CD28.2, APC
Applications | FC |
Reactivities | Human, Primate |
Conjugation | APC |
CD28 mouse monoclonal antibody, clone CD28.2, FITC
Applications | FC |
Reactivities | Human, Primate |
Conjugation | FITC |
CD28 mouse monoclonal antibody, clone CD28.2, PE
Applications | FC |
Reactivities | Human, Primate |
Conjugation | PE |
hCG (CGA) mouse monoclonal antibody, clone n.a, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Fas Ligand (FASLG) mouse monoclonal antibody, clone B-R17, Biotin
Applications | FC |
Reactivities | Human |
Conjugation | Biotin |
Perforin (PRF1) mouse monoclonal antibody, clone B-D48, FITC
Applications | FC |
Reactivities | Human |
Conjugation | FITC |
Perforin (PRF1) mouse monoclonal antibody, clone B-D48, PerCP
Applications | FC |
Conjugation | PerCP |
Perforin (PRF1) mouse monoclonal antibody, clone B-D48, Purified
Applications | FC |
Reactivities | Human |
Perforin (PRF1) mouse monoclonal antibody, clone B-D48, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
CD40 mouse monoclonal antibody, clone B-B20, Biotin
Applications | FC |
Reactivities | Human |
Conjugation | Biotin |
CD40 mouse monoclonal antibody, clone B-B20, FITC
Applications | FC |
Reactivities | Human |
Conjugation | FITC |