Germany
Japan
United Kingdom
China
Antibodies
View as table Download
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit Polyclonal Anti-ABCB4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABCB4 antibody: synthetic peptide directed towards the N terminal of human ABCB4. Synthetic peptide located within the following region: AGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKEIGIKKAISANISM |
Goat Polyclonal Antibody against ABCC8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EFDKPEKLLSRKD, from the C Terminus of the protein sequence according to NP_000343.2. |
Rabbit Polyclonal Anti-ABCG2(CD338) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABCG2(CD338) Antibody: Peptide sequence around aa.160~164( R-I-N-R-V) derived from Human ABCG2(CD338). |
Mouse anti-ABCA1 monoclonal antibody
| Applications | WB |
| Reactivities | Chicken, Human, Mouse |
| Conjugation | Unconjugated |
Mouse Anti-ABCA4 (Rim Protein) Antibody
| Applications | IHC |
| Reactivities | Bovine, Human, Mouse, Xenopus |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-Abca7 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Abca7 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: DTQTRHLSGGMQRKLSVAIAFVGGSRVVIMDEPTAGVDPASRRGIWELLL |
Rabbit Polyclonal Anti-ABCB4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABCB4 antibody: synthetic peptide directed towards the middle region of human ABCB4. Synthetic peptide located within the following region: GRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSV |
Rabbit anti-ABCD3 polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from human ABCD3. |
Rabbit Polyclonal Anti-ABCG5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ABCG5 Antibody: synthetic peptide directed towards the middle region of human ABCG5. Synthetic peptide located within the following region: CGYPCPEHSNPFDFYMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICH |
Rabbit Polyclonal ABCA1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Hamster |
| Conjugation | Unconjugated |
| Immunogen | Partial peptide sequence (peptide used resides somewhere between a.a 1100-1300) of the human ABCA1 gene. Actual immunogen sequence is proprietary information. |
ABCA1 (1800-2260) mouse monoclonal antibody, clone AB1.G6, Aff - Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Human |
Goat Polyclonal Antibody against ABCC5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KDIDIGKEYIIP-C, from the N Terminus of the protein sequence according to NP_005679.2; NP_001018881.1. |
Goat Anti-ABCC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HQSDLKVDENQKAYY, from the internal region of the protein sequence according to NP_004987.2; NP_063915.2; NP_063953.2;NP_063954.2; NP_063955.2. |
Rabbit Polyclonal Anti-ABCA12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ABCA12 Antibody: synthetic peptide directed towards the middle region of human ABCA12. Synthetic peptide located within the following region: TTIFKMLTGDIIPSSGNILIRNKTGSLGHVDSHSSLVGYCPQEDALDDLV |
Rabbit Polyclonal Anti-ABCB6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABCB6 antibody: synthetic peptide directed towards the middle region of human ABCB6. Synthetic peptide located within the following region: VTEWRTKFRRAMNTQENATRARAVDSLLNFETVKYYNAESYEVERYREAI |
P Glycoprotein (ABCB1) mouse monoclonal antibody, clone PG-13, Purified
| Applications | IF, IHC, WB |
| Reactivities | Human |
Rabbit polyclonal anti-ABCB10 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCB10. |
Rabbit polyclonal anti-ABCD4 antibody
| Applications | WB |
| Reactivities | Human Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCD4. |
Rabbit polyclonal anti-ABCD1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCD1. |
Rabbit polyclonal anti-ABCA8 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCA8. |
Rabbit polyclonal anti-ABCA6 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human ABCA6. |
Rabbit polyclonal anti-ABCA13 antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCA13. |
Rabbit polyclonal anti-ABCB1 antibody
| Applications | WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 262-277 of human ABCB1 protein. |
Rabbit Polyclonal Anti-TAP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TAP1 Antibody: synthetic peptide directed towards the middle region of human TAP1. Synthetic peptide located within the following region: LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL |
Rabbit Polyclonal Anti-Abcc2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Abcc2 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: TIQDVNLDIKPGQLVAVVGTVGSGKSSLISAMLGEMENVHGHITIKGSIA |
Rabbit Polyclonal Anti-ABCC8 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ABCC8 Antibody: synthetic peptide directed towards the N terminal of human ABCC8. Synthetic peptide located within the following region: PLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGW |
Rabbit Polyclonal ABCB5 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal ABCA8 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Active filters
Pathways
- ABC transporters
Filter by
Category
Target Symbol
- ABCB1 (168)
- ABCC5 (33)
- ABCD1 (33)
- ABCD2 (12)
- ABCC2 (10)
- ABCB5 (8)
- ABCA1 (7)
- ABCD4 (7)
- ABCG2 (7)
- ABCC1 (6)
- ABCC3 (6)
- CFTR (6)
- ABCB8 (5)
- ABCB9 (5)
- ABCB10 (4)
- ABCB6 (4)
- ABCC4 (4)
- ABCD3 (4)
- ABCG1 (4)
- TAP2 (4)
- ABCB7 (3)
- ABCC10 (3)
- ABCC8 (3)
- ABCG5 (3)
- ABCA2 (2)
- ABCA4 (2)
- ABCA6 (2)
- ABCA7 (2)
- ABCA8 (2)
- ABCB11 (2)
- ABCB4 (2)
- ABCC11 (2)
- ABCC12 (2)
- ABCC9 (2)
- ABCG4 (2)
- TAP1 (2)
- ABCA12 (1)
- ABCA13 (1)
- ABCA5 (1)
- ABCA9 (1)
- ABCG8 (1)