Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit anti-NF-kB p105/p50 (Phospho-Ser337) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanNF-κB p105/p50 around the phosphorylation site of serine 337 (R-K-SP-D-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal eNOS (Thr495) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human eNOS around the phosphorylation site of threonine 495 (K-K-TP-F-K). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-LAMA1 antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LAMA1. |
Mouse Monoclonal iNOS Antibody (4E5)
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
TA336918 is a replacement of AM06772PU-N.
Rabbit Polyclonal NF- kappaB p105/p50 (Ser932) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human NF- kappaB p105/p50 around the phosphorylation site of Serine 932 |
| Modifications | Phospho-specific |
Phospho-NOS3-S1177 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S1177 of human NOS3 |
| Modifications | Phospho-specific |
Rabbit Polyclonal antibody to Laminin beta 3 (laminin, beta 3)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 644 and 960 of Laminin beta 3 (Uniprot ID#Q13751) |
Rabbit Polyclonal p53 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-p53 antibody: human p53 (tumor protein p53), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of the protein. |
Rabbit Polyclonal Antibody against PIK3CA (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA. |
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
Rabbit polyclonal anti-LAMC1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human LAMC1. |
Rabbit Polyclonal PI3-kinase p85- alpha (Tyr607) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha around the phosphorylation site of Tyrosine 607 |
| Modifications | Phospho-specific |
Rabbit Polyclonal cIAP2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit anti-NOS2A polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human NOS2A. |
Rabbit polyclonal Caspase 9 (Tyr153) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of tyrosine 153 (L-A-YP-I-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit Polyclonal MYC Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human MYC |
Rabbit Polyclonal Anti-LAMC1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LAMC1 antibody: synthetic peptide directed towards the middle region of human LAMC1. Synthetic peptide located within the following region: GYHVKTEDPDLRTSSWIKQFDTSRFHPQDLSRSQKCIRKEGSSEISQRVQ |
Active filters
Reactivities
- Human
Pathways
- Small cell lung cancer
Filter by
Target Symbol
- TP53 (238)
- AKT1 (114)
- BCL2 (89)
- PIK3CG (64)
- CDK2 (63)
- RB1 (56)
- PIK3R5 (46)
- PTGS2 (44)
- RELA (44)
- BIRC3 (43)
- AKT2 (41)
- MYC (41)
- IKBKG (38)
- LAMB3 (38)
- CDKN2B (35)
- PIK3CD (35)
- NFKB1 (33)
- CCND1 (30)
- FN1 (30)
- FHIT (28)
- NFKBIA (28)
- PTK2 (28)
- BCL2L1 (27)
- NOS2 (27)
- PIK3CA (24)
- ITGB1 (22)
- CHUK (20)
- PIAS2 (20)
- CASP9 (19)
- IKBKB (18)
- AKT3 (17)
- MAX (17)
- CYCS (15)
- NOS3 (15)
- PTEN (15)
- LAMA4 (14)
- TRAF5 (13)
- CCNE1 (12)
- ITGAV (12)
- APAF1 (10)
- E2F1 (10)
- CDKN1B (9)
- PIK3R1 (9)
- TRAF2 (9)
- ITGA2 (8)
- ITGA6 (8)
- PIAS1 (8)
- TRAF6 (8)
- E2F2 (7)
- RARB (7)
- CDK4 (6)
- CDK6 (6)
- LAMB2 (6)
- RXRA (6)
- RXRB (6)
- RXRG (6)
- TRAF3 (6)
- XIAP (6)
- BIRC2 (5)
- CCNE2 (5)
- PIAS3 (5)
- COL4A1 (4)
- LAMA1 (4)
- LAMB1 (4)
- NOS1 (4)
- PIAS4 (4)
- PIK3CB (4)
- PIK3R3 (4)
- TRAF1 (4)
- E2F3 (3)
- ITGA2B (3)
- LAMC1 (3)
- SKP2 (3)
- CASPASE 9 (2)
- CIAP2 (2)
- COL4A6 (2)
- ITGA3 (2)
- LAMA3 (2)
- LAMA5 (2)
- LAMC3 (2)
- PIK3R2 (2)
- TRAF4 (2)
- CKS1B (1)
- COL4A2 (1)
- COL4A4 (1)
- LAMA2 (1)
- LAMC2 (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (1670)
- Transcription Factors (579)
- Stem cell - Pluripotency (452)
- ES Cell Differentiation/IPS (431)
- Protein Kinase (313)
- Transmembrane (172)
- Secreted Protein (98)
- Stem cell relevant signaling - JAK/STAT signaling pathway (91)
- Stem cell relevant signaling - Wnt Signaling pathway (71)
- Stem cell relevant signaling - DSL/Notch pathway (42)
- Embryonic stem cells (41)
- Induced pluripotent stem cells (41)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (41)
- Nuclear Hormone Receptor (25)
- Protease (21)
- Phosphatase (15)