Coronavirus Research Products

View as table Download

SARS S mouse monoclonal antibody, clone 4A6C9, Supernatant

Applications ELISA, WB
Temporarily out of stock

SARS M mouse monoclonal antibody, clone 2H2C4, Supernatant

Applications ELISA, WB
Temporarily out of stock

Feline Coronavirus mouse monoclonal antibody, clone FIPV3-70, Purified

Applications ELISA, FC, IF, IHC, WB

Rabbit Polyclonal Anti-MASP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MASP2 antibody: synthetic peptide directed towards the N terminal of human MASP2. Synthetic peptide located within the following region: FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK

SARS M (C-term) rabbit polyclonal antibody, Serum

Applications EM, IF, IP, WB
Immunogen BSAcoupled Synthetic peptide corresponding to the C-terminus (amino acid residues 204-221) of the SARS Coronavirus Membrane protein

Rabbit Polyclonal Anti-ACE2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ACE2 Antibody: A synthesized peptide

Angiotensin Converting Enzyme 2 (ACE2) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide corresponding to amino acids near the center of human ACE2. The immunogen is located within aa 180-230 of ACE2.

Rabbit Polyclonal Anti-Masp2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Masp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YPQPYPKLSSCTYSIRLEDGFSVILDFVESFDVETHPEAQCPYDSLKIQT

Rabbit Polyclonal Anti-CD147 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-CD147 Antibody: A synthesized peptide derived from human CD147

SARS N rabbit polyclonal antibody, Purified

Applications ELISA, WB
Immunogen Recombinant protein corresponding to full length SARS Coronavirus Nucleocapsid protein

Angiotensin Converting Enzyme 2 (ACE2) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen ACE2 antibody was raised against synthetic peptide

Angiotensin Converting Enzyme 2 (ACE2) (N-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen ACE2 antibody was raised against synthetic peptide

Angiotensin Converting Enzyme 2 (ACE2) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide corresponding to a sequence within the amino terminus of Human ACE2.

Feline Coronavirus mouse monoclonal antibody, clone CCV2-2, Biotin

Applications ELISA
Conjugation Biotin

Angiotensin Converting Enzyme 2 (ACE2) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse

Rabbit Polyclonal Anti-SARS Spike Antibody

Reactivities Virus
Immunogen SARS Spike antibody was raised against a synthetic peptide corresponding to amino acids near the center of. The sARS Spike glycoprotein.

Rabbit Polyclonal Anti-SARS Spike Antibody

Reactivities Virus
Immunogen SARS Spike antibody was raised against a synthetic peptide corresponding to amino acids near the center of. The sARS Spike glycoprotein.

Rabbit Polyclonal Anti-SARS Spike Antibody

Reactivities Virus
Immunogen SARS Spike antibody was raised against a synthetic peptide corresponding to amino acids near the center of. The sARS Spike glycoprotein.

Rabbit Polyclonal Anti-SARS Spike Antibody

Reactivities Virus
Immunogen SARS Spike antibody was raised against a synthetic peptide corresponding to amino acids at the carboxy terminus of the SARS Spike glycoprotein.

Rabbit Polyclonal Anti-SARS Matrix Antibody

Reactivities Virus
Immunogen SARS matrix antibody was raised against a synthetic peptide corresponding to amino acids at the amino-terminus of the SARS matrix protein.

Rabbit Polyclonal Anti-SARS Matrix Antibody

Reactivities Virus
Immunogen SARS matrix antibody was raised against a synthetic peptide corresponding to 15 amino acids at the carboxy terminus of the SARS matrix protein.

Rabbit Polyclonal Anti-SARS Envelope Antibody

Reactivities Virus
Immunogen SARS envelope antibody was raised against a synthetic peptide corresponding to amino acids at the amino-terminus of the SARS envelope protein.

Rabbit Polyclonal Anti-SARS Envelope Antibody

Reactivities Virus
Immunogen SARS envelope antibody was raised against a synthetic peptide corresponding to amino acids at the carboxy terminus of the SARS envelope protein.