WNT Pathway Markers-Antibodies

View as table Download

MEK4 (MAP2K4) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human Mouse Rat
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human SEK1/MKK4 around the phosphorylation site of serine 80 (T-H-Sp-I-E).

MEK4 (MAP2K4) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human Mouse Rat
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human SEK1/MKK4 around the phosphorylation site of serine 80 (T-H-Sp-I-E).

CCK4 (PTK7) (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen A 15 amino acid peptide located near the N-terminal region of human PTK7.

MEK4 (MAP2K4) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide, corresponding to amino acids 50-100 of Human MEK-4.

Frizzled 9 (FZD9) (N-term, Extracel. Dom.) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Bovine, Canine, Human, Mouse, Rabbit, Rat
Immunogen FZD9 antibody was raised against synthetic peptide from N-terminal extracellular domain of human FZD9 / Frizzled 9.

Frizzled 9 (FZD9) (3rd Extracell. Dom.) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Human
Immunogen Synthetic 17 amino acid peptide from 3rd extracellular domain of human FZD9 / Frizzled 9

JNK2 (MAPK9) (373-389) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Bovine, Bat, Human, Porcine, Rabbit
Immunogen Synthetic peptide corresponding to amino acids 373-389 of human JNK2

TROY (TNFRSF19) (29-44, 204-219, 409-421) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen A mixture of synthetic peptides corresponding to amino acids 29-44, 204-219, and 409-421 of Human TROY.

JNK1 (MAPK8) pThr183/pTyr185 rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human JNK1/JNK2 around the phosphorylation site of Thr183/Tyr185 (M-M-Tp-P-YP-V-V).

JNK1 (MAPK8) pThr183/pTyr185 rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human JNK1/JNK2 around the phosphorylation site of Thr183/Tyr185 (M-M-Tp-P-YP-V-V).

JNK3 (MAPK10) (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of human MAPK10.

JLP (SPAG9) (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 98~128 amino acids from the N-terminal region of Human SPAG9

JLP (SPAG9) (Center) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 610~640 amino acids from the Center region of Human JLP/SPAG9.

JNK3 (MAPK10) (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 1~30 amino acids from the N-terminal region of Human JNK3

ROR2 rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen This antibody is generated from rabbits immunized with a recombinant protein of human ROR2.

RYK (C-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human RYK.

CCK4 (PTK7) (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the N-terminal region of human CCK4.

MEK4 (MAP2K4) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC
Reactivities Human, Mouse, Rat

ROCK1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

JNK1 (MAPK8) (+JNK2/3) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

ROCK2 rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen ROCK2 antibody was raised against synthetic peptide

ROCK2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence at the N-terminal of human ROCK2

WNT9A (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence at the C-terminal of human WNT9A

JNK1 (MAPK8) (Thr183/Tyr185) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 159-195 amino acids from human MAPK8 / JNK1

MEK7 (MAP2K7) pSer271 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Peptide sequence around phosphorylation site of Serine 271(V-D-S(p)-K-A) derived from Human MAP2K7 (KLH-conjugated)

WNT1 rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) recombinant human WNT-1

WNT1 rabbit polyclonal antibody, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Immunogen Highly pure (>98%) recombinant human WNT-1

TCF4 rabbit polyclonal antibody

Applications IP, WB
Reactivities Chicken, Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal PTK7 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PTK7 antibody was raised against a 15 amino acid peptide from near the amino terminus of human PTK7.

Rabbit Polyclonal antibody to JNK1 (mitogen-activated protein kinase 8)

Applications IF, WB
Reactivities Human, Mouse
Immunogen Recombinant fragment corresponding to a region within amino acids 5 and 300 of JNK1 (Uniprot ID#P45983)

Rabbit polyclonal anti-FZD5 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FZD5.

WNT7A Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Chimpanzee, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon
Immunogen WNT7A antibody was raised against synthetic 10 amino acid peptide from internal region of human WNT7A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Opossum (100%); Chicken, Platypus, Xenopus (80%).

WNT7A Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Bat, Bovine, Chimpanzee, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Xenopus, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen WNT7A antibody was raised against synthetic 12 amino acid peptide from internal region of human WNT7A. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig, Guinea pig, Turkey, Zebra finch, Chicken, Platypus, Lizard, Xenopus (100%); Seabass (92%); Stickleback, Pufferfish, Zebrafish (83%).

Rabbit Polyclonal ROCK1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ROCK1 antibody was raised against a 15 amino acid synthetic peptide near the amino terminus of human ROCK1.

Rabbit Polyclonal APC2 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen APC2 antibody was raised against an 18 amino acid synthetic peptide near the center of human APC2.

Rabbit Polyclonal APC13 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen APC13 antibody was raised against a 17 amino acid synthetic peptide near the center of human APC13. The immunogen is located within the last 50 amino acids of APC13.

Rabbit Polyclonal APC11 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen APC11 antibody was raised against an 18 amino acid synthetic peptide near the center of human APC11.

Anti-FZD2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 188-200 amino acids of human frizzled family receptor 2

Anti-WNT9A Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 273 amino acids of human wingless-type MMTV integration site family, member 9A

Anti-FZD1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 1-14 amino acids of human frizzled family receptor 1

Anti-MAPK8/MAPK9/MAPK10 (phospho-Thr183/Tyr185) Rabbit Polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of Thr183/Tyr185 (M-M-T(p)-P-Y(p)- V - V ) derived from Human JNK1/JNK2/JNK3.
Modifications Phospho-specific

Rabbit polyclonal RORA Antibody (T216)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This RORA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 193-222 amino acids from human RORA.

Rabbit polyclonal TCF21 Antibody (C-term)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TCF21 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 144-173 amino acids from the C-terminal region of human TCF21.

Rabbit polyclonal LEF1 Antibody (N-term)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This LEF1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 10-37 amino acids from the N-terminal region of human LEF1.

Rabbit polyclonal WNT16 Antibody (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This WNT16 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 236-265 amino acids from the C-terminal region of human WNT16.

Rabbit polyclonal TCF25 Antibody (N-term)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TCF25 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from the N-terminal region of human TCF25.

Rabbit Polyclonal SAPK/JNK Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human SAPK/JNK

Rabbit Polyclonal Anti-DVL2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DVL2 antibody: synthetic peptide directed towards the N terminal of human DVL2. Synthetic peptide located within the following region: AGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPA

Rabbit Polyclonal Anti-RORA Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RORA antibody: synthetic peptide directed towards the N terminal of human RORA. Synthetic peptide located within the following region: FGILQILHQCILSSGDAFVLTGVCCSWRQNGKPPYSQKEDKEVQTGYMNA

Rabbit Polyclonal TCF7L2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of human TCF7L2 (within residues 150-200). [Swiss-Prot# Q9NQB0]