Rabbit polyclonal Estrogen Receptor-a (Ab-537) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Estrogen Receptor-a around the phosphorylation site of tyrosine 537 (P-L-YP-D-L). |
Rabbit polyclonal Estrogen Receptor-a (Tyr537) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ER-a around the phosphorylation site of tyrosine 537 (P-L-YP-D-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal Estrogen Receptor-a (Ser102) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Estrogen Receptor-a around the phosphorylation site of serine 102 (L-N-SP-V-S). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-Estrogen Receptor- alpha (Tyr537) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Estrogen Receptor- alpha around the phosphorylation site of Tyrosine 537 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-Estrogen Receptor- alpha (Ser104) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Estrogen Receptor- alpha around the phosphorylation site of Serine 104 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-Estrogen Receptor- alpha (Ser106) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Estrogen Receptor- alpha around the phosphorylation site of Serine 106 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-Estrogen Receptor- alpha (Ser118) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Estrogen Receptor- alpha around the phosphorylation site of Serine 118 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-Estrogen Receptor- beta (Ser105) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Estrogen Receptor- beta around the phosphorylation site of Serine 105 |
Rabbit Polyclonal Anti-RORA Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RORA antibody: synthetic peptide directed towards the middle region of human RORA. Synthetic peptide located within the following region: GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP |
Rabbit anti-ESR2 (Estrogen Receptor-beta, Phospho-Ser118) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human and Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanEstrogen Receptor-α around the phosphorylation site of serine 118 (Q-L-SP-P-F). |
| Modifications | Phospho-specific |
Rabbit anti-ESR2 (Estrogen Receptor-beta, Phospho-Ser167) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanEstrogen Receptor-α around the phosphorylation site of serine 167 (L-A-SP-T-N). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Phospho-Estrogen Receptor- alpha (Ser167) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human:S167 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Estrogen Receptor- alpha around the phosphorylation site of Serine 167 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-RORA Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RORA antibody: synthetic peptide directed towards the N terminal of human RORA. Synthetic peptide located within the following region: FGILQILHQCILSSGDAFVLTGVCCSWRQNGKPPYSQKEDKEVQTGYMNA |
Rabbit anti Estrogen Receptor alpha (ER-alpha) Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the C-terminus of human estrogen receptor protein. This sequence is identical to human, Gorilla, Bovine, etc. |
Estrogen Receptor 1 (ESR1) pSer104 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
Estrogen Receptor 1 (ESR1) pSer118 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
Estrogen Receptor 1 (ESR1) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
Estrogen Receptor 1 (ESR1) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
Estrogen Receptor 1 (ESR1) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal Anti-RORA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RORA antibody: synthetic peptide directed towards the N terminal of human RORA. Synthetic peptide located within the following region: ARKSEPPAPVRRQSYSSTSRGISVTKKTHTSQIEIIPCKICGDKSSGIHY |
Rabbit Polyclonal Anti-Rora Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Rora antibody is synthetic peptide directed towards the middle region of Mouse Rora. Synthetic peptide located within the following region: STYMDGHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPA |
Rabbit Polyclonal Anti-RORA Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RORA antibody: synthetic peptide directed towards the middle region of human RORA. Synthetic peptide located within the following region: GFMELCQNDQIVLLKAGSLEVVFIRMCRAFDSQNNTVYFDGKYASPDVFK |
Rabbit Polyclonal Anti-RORA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RORA antibody: synthetic peptide directed towards the N terminal of human RORA. Synthetic peptide located within the following region: ARKSEPPAPVRRQSYSSTSRGISVTKKTHTSQIEIIPCKICGDKSSGIHY |
Rabbit Polyclonal Anti-RORA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RORA antibody: synthetic peptide directed towards the N terminal of human RORA. Synthetic peptide located within the following region: CGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRTSRNRC |
Rabbit Polyclonal Anti-RORA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RORA antibody: synthetic peptide directed towards the middle region of human RORA. Synthetic peptide located within the following region: PGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDI |
Rabbit Polyclonal Anti-ESR2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ESR2 |
Rabbit Polyclonal Anti-RORA rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human RORA |
Germany
Japan
United Kingdom
China
