Germany
Japan
United Kingdom
China
Research Areas
Download
Rabbit Polyclonal Anti-FZD9 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD9 antibody: synthetic peptide directed towards the N terminal of human FZD9. Synthetic peptide located within the following region: RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF |
Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP |
Rabbit Polyclonal Anti-MASP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MASP2 antibody: synthetic peptide directed towards the N terminal of human MASP2. Synthetic peptide located within the following region: FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK |
Rabbit Polyclonal CD10 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
PD1 (PDCD1) rabbit polyclonal antibody, Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide corresponding to 16 Amino Acid from near the carboxy terminus of Human PDCD1. |
Frizzled 2 (FZD2) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_001457.1. |
Rabbit polyclonal antibody to CD41/Integrin alpha 2b (integrin, alpha 2b (platelet glycoprotein IIb of IIb/IIIa complex, antigen CD41))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 210 and 532 of Integrin alpha 2b (Uniprot ID#P08514) |
Rabbit polyclonal antibody to CD74 (CD74 molecule, major histocompatibility complex, class II invariant chain)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 58 of CD74 (Uniprot ID#P04233) |
Rabbit Polyclonal Anti-WNT2B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide directed towards the middle region of human WNT2B. Synthetic peptide located within the following region: LRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRT |
WNT3A rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Immunogen | E.Coli derived recombinant Human WNT-3a |
Rabbit Polyclonal Antibody against CD8A (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A. |
Rabbit polyclonal PECAM-1 (Tyr713) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PECAM-1 around the phosphorylation site of tyrosine 713 (T-V-YP-S-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-APC10 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids near the amino terminus of human APC10. |
Rabbit polyclonal anti-IL6 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Anti-IL-6 is an IgG fraction antibody prepared from rabbit antiserum after repeated immunizations with recombinant mouse IL-6 protein produced in E.coli. |
Rabbit Polyclonal ROCK1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ROCK1 |
Rabbit Polyclonal Anti-FZD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD4 antibody: synthetic peptide directed towards the middle region of human FZD4. Synthetic peptide located within the following region: GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV |
Rabbit Polyclonal Anti-WNT2B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT2B antibody: synthetic peptide directed towards the N terminal of human WNT2B. Synthetic peptide located within the following region: LRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLLT |
Periostin (POSTN) rabbit polyclonal antibody, Azide Free
| Applications | ELISA, IHC, WB |
| Reactivities | Chicken, Human, Mouse, Rat |
| Immunogen | Recombinant Human OSF-2 Source of Antigen: E. coli. |
Rabbit Polyclonal antibody to WNT11 (wingless-type MMTV integration site family, member 11)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 310 of WNT11 (Uniprot ID#O96014) |
Rabbit polyclonal WNT5B Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This WNT5B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 153-182 amino acids from the Central region of human WNT5B. |
Rabbit polyclonal IL8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8. |
Rabbit Polyclonal JNK1/2/3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 |
Rabbit Polyclonal Anti-MAPK10 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat, Tobacco hornworm |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mapk10 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL |
Active filters
Category
-
Antibodies
- Primary Antibodies
Clonalities
- Polyclonal
Filter by
Target Symbol
- MAPK8 (28)
- ESR1 (22)
- IL6 (19)
- KIT (18)
- ROCK2 (17)
- RORA (13)
- CEBPB (12)
- TNF (12)
- WNT1 (12)
- FZD4 (11)
- IL6ST (11)
- TLR4 (11)
- CASP1 (10)
- CEBPD (10)
- LEF1 (10)
- PECAM1 (10)
- TLR2 (10)
- WNT2B (10)
- ANAPC5 (9)
- CD19 (9)
- LRP6 (9)
- ROCK1 (9)
- FZD2 (8)
- IL1RN (8)
- ITGB3 (8)
- TCF25 (8)
- TLR3 (8)
- WNT10A (8)
- WNT5B (8)
- CD14 (7)
- ESR2 (7)
- FZD1 (7)
- FZD8 (7)
- FZD9 (7)
- IL1B (7)
- LRP5 (7)
- MME (7)
- PTPRC (7)
- ROR1 (7)
- TCF4 (7)
- WNT16 (7)
- WNT2 (7)
- WNT4 (7)
- WNT6 (7)
- ANAPC10 (6)
- CD274 (6)
- CD34 (6)
- CD8A (6)
- DVL2 (6)
- FZD10 (6)
- IL12B (6)
- TCF7L2 (6)
- TLR5 (6)
- TLR6 (6)
- TLR8 (6)
- WNT9A (6)
- DVL3 (5)
- FZD3 (5)
- FZD5 (5)
- FZD6 (5)
- HLA-DMB (5)
- HLA-DPB1 (5)
- IL18R1 (5)
- IL1R1 (5)
- IL2RA (5)
- IL36RN (5)
- ITGAX (5)
- MS4A1 (5)
- PTK7 (5)
- TSLP (5)
- WNT11 (5)
- WNT3A (5)
- WNT5A (5)
- ANAPC13 (4)
- CD68 (4)
- ENTPD6 (4)
- FUT4 (4)
- HLA-DQB1 (4)
- HLA-DRB1 (4)
- IL10 (4)
- IL2 (4)
- IL3RA (4)
- IL4 (4)
- MAPK10 (4)
- MAPK9 (4)
- NCAM1 (4)
- TCF21 (4)
- TLR7 (4)
- TLR9 (4)
- TNFRSF8 (4)
- AGBL2 (3)
- AGBL3 (3)
- ANAPC11 (3)
- ANAPC15 (3)
- ANAPC2 (3)
- APC2 (3)
- CCP110 (3)
- CD3E (3)
- CD46 (3)
- CD5 (3)
Reactivities
- Human (765)
- Mouse (463)
- Rat (332)
- Bovine (27)
- Monkey (21)
- Dog (19)
- Chicken (13)
- Rabbit (13)
- Gorilla (10)
- Hamster (10)
- Bat (9)
- Horse (9)
- Gibbon (8)
- Pig (8)
- Canis (5)
- Canine (4)
- Cow (3)
- Primate (3)
- Xenopus (3)
- Chimpanzee (2)
- Guinea Pig (2)
- C. elegans (1)
- Macaque (1)
- Opossum (1)
- Orang-Utan (1)
- Porcine (1)
- Rhesus Monkey (1)
- Sheep (1)
- Tobacco hornworm (1)
Applications
Antibody Hosts
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (490)
- Transmembrane (314)
- Secreted Protein (153)
- ES Cell Differentiation/IPS (144)
- Protein Kinase (78)
- Transcription Factors (77)
- Adult stem cells (59)
- GPCR (44)
- Nuclear Hormone Receptor (36)
- Cancer stem cells (30)
- Stem cell relevant signaling - Wnt Signaling pathway (30)
- Embryonic stem cells (20)
- Protease (20)
- Stem cell - Pluripotency (17)
- Induced pluripotent stem cells (7)
- Phosphatase (6)
Pathways
- Wnt signaling pathway (207)
- Pathways in cancer (202)
- Melanogenesis (158)
- Basal cell carcinoma (146)
- Colorectal cancer (102)
- Toll-like receptor signaling pathway (98)
- Hematopoietic cell lineage (96)
- Cytokine-cytokine receptor interaction (82)
- Hedgehog signaling pathway (73)
- Focal adhesion (56)
- MAPK signaling pathway (55)
- NOD-like receptor signaling pathway (55)
- Progesterone-mediated oocyte maturation (43)
- Fc epsilon RI signaling pathway (40)
- Regulation of actin cytoskeleton (40)
- RIG-I-like receptor signaling pathway (39)
- Adipocytokine signaling pathway (37)
- Cell adhesion molecules (CAMs) (37)
- Jak-STAT signaling pathway (37)
- T cell receptor signaling pathway (36)
- Pathogenic Escherichia coli infection (34)
- Epithelial cell signaling in Helicobacter pylori infection (33)
- Type II diabetes mellitus (33)
- Neurotrophin signaling pathway (32)
- ErbB signaling pathway (31)
- GnRH signaling pathway (31)
- Graft-versus-host disease (28)
- Leukocyte transendothelial migration (28)
- Pancreatic cancer (28)
- Insulin signaling pathway (27)
- TGF-beta signaling pathway (26)
- Acute myeloid leukemia (24)
- Allograft rejection (24)
- Chemokine signaling pathway (24)
- Axon guidance (22)
- Endocytosis (22)
- Primary immunodeficiency (22)
- Type I diabetes mellitus (22)
- Cytosolic DNA-sensing pathway (21)
- Hypertrophic cardiomyopathy (HCM) (21)
- Apoptosis (20)
- Vascular smooth muscle contraction (20)
- Asthma (18)
- Alzheimer's disease (17)
- Amyotrophic lateral sclerosis (ALS) (17)
- Antigen processing and presentation (17)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (17)
- Autoimmune thyroid disease (16)
- Cell cycle (16)
- Oocyte meiosis (16)
- Systemic lupus erythematosus (16)
- Ubiquitin mediated proteolysis (16)
- B cell receptor signaling pathway (15)
- Dilated cardiomyopathy (13)
- Endometrial cancer (13)
- Prion diseases (13)
- Adherens junction (11)
- Natural killer cell mediated cytotoxicity (11)
- Renin-angiotensin system (11)
- Prostate cancer (10)
- Thyroid cancer (10)
- Viral myocarditis (10)
- Fc gamma R-mediated phagocytosis (8)
- Notch signaling pathway (8)
- ECM-receptor interaction (7)
- Complement and coagulation cascades (5)
- Metabolic pathways (3)
- PPAR signaling pathway (3)
- Small cell lung cancer (3)
- Bladder cancer (2)
- Glutathione metabolism (2)
- Purine metabolism (2)
- Pyrimidine metabolism (2)
- Renal cell carcinoma (2)
- VEGF signaling pathway (2)
- Glycosphingolipid biosynthesis - lacto and neolacto series (1)
- Huntington's disease (1)
- Long-term depression (1)
- Lysosome (1)
- Parkinson's disease (1)