Germany
Japan
United Kingdom
China
CD56 (NCAM1) mouse monoclonal antibody, clone 123C3.D5 + 123A8, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human |
Research Areas
CD68 mouse monoclonal antibody, clone C68/684, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Monkey |
CD68 mouse monoclonal antibody, clone KP1 + C68/684, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Feline, Human, Monkey, Mouse, Rat |
CD46 mouse monoclonal antibody, clone AT2G9, Purified
| Applications | ELISA, FC, IF, IHC, WB |
| Reactivities | Human |
CD46 mouse monoclonal antibody, clone AT2G9, Purified
| Applications | ELISA, FC, IF, IHC, WB |
| Reactivities | Human |
Frizzled 5 (FZD5) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
IL1 Receptor II (IL1R2) rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human |
| Immunogen | Recombinant Human IL-1R type II. |
TNFRSF1B mouse monoclonal antibody, clone utr1, Biotin
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Biotin |
CD56 (NCAM1) mouse monoclonal antibody, clone RNL-1, Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
IL6 goat polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure (> 98%), 20.9 kDa E.coli derived recombinant Human IL-6 |
IL6 goat polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure (> 98%), 20.9 kDa E.coli derived recombinant Human IL-6 |
CD13 (ANPEP) mouse monoclonal antibody, clone WM15, Purified
| Applications | ELISA, FC, IHC, IP |
| Reactivities | Human |
CD45 (PTPRC) (CD45RB) mouse monoclonal antibody, clone MEM-55, Purified
| Applications | FC, IHC, IP, WB |
| Reactivities | Human, Primate, Rabbit |
TLR2 mouse monoclonal antibody, clone TL2.1, Biotin
| Applications | FC, IF, IHC, WB |
| Reactivities | Canine, Human, Monkey |
| Conjugation | Biotin |
Frizzled 9 (FZD9) (N-term, Extracel. Dom.) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Bovine, Canine, Human |
| Immunogen | Synthetic 15 amino acid peptide from N-terminal extracellular domain of human FZD9 / Frizzled 9 |
Rabbit Polyclonal Antibody against CD14 (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD14 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 292-322 amino acids from the C-terminal region of human CD14. |
Rabbit polyclonal antibody to ROCK1 (Rho-associated, coiled-coil containing protein kinase 1)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 107 and 371 of ROCK1 |
Rabbit polyclonal Neprilysin Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Neprilysin antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 506-534 amino acids from the C-terminal region of human Neprilysin. |
Rabbit Polyclonal C/EBP- beta (Thr235/188) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human C/EBP- beta around the phosphorylation site of Threonine 235/188 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-WNT5B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT5B antibody: synthetic peptide directed towards the middle region of human WNT5B. Synthetic peptide located within the following region: YCLRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHC |
USD 465.00
2 Weeks
JNK1 (MAPK8) (pT-G/P-pY Motif) (incl. pos. control) mouse monoclonal antibody, clone 9H8, Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Human, Mouse |
USD 465.00
2 Weeks
MEK7 (MAP2K7) (incl. pos. control) mouse monoclonal antibody, clone 10F7, Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Canine, Human, Mouse, Rat |
TNFRSF1B mouse monoclonal antibody, clone 2/220, Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
CD79A (202-216) mouse monoclonal antibody, clone HM57, Purified
| Applications | FC, IHC, WB |
| Reactivities | Bison, Bovine, Canine, Chicken, Deer, Equine, Guinea Pig, Human, Monkey, Mouse, Porcine, Rabbit, Rat |
IL2 Receptor alpha (IL2RA) mouse monoclonal antibody, Azide Free
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
Active filters
Category
-
Antibodies
- Primary Antibodies
Filter by
Target Symbol
- CD4 (130)
- PECAM1 (121)
- PTPRC (97)
- CD19 (90)
- KIT (89)
- CD99 (87)
- PDCD1 (87)
- LGALS3 (82)
- CD68 (74)
- MS4A1 (70)
- CD5 (69)
- CD34 (68)
- NCAM1 (65)
- MAPK8 (64)
- ESR1 (62)
- TNFRSF8 (57)
- IL6 (51)
- CR2 (49)
- CD274 (48)
- MME (47)
- WNT3 (47)
- IL1RN (44)
- DVL2 (42)
- CD2 (41)
- CD8A (41)
- CD22 (39)
- CRP (38)
- FCER2 (38)
- IL2RA (38)
- TNF (37)
- TYRO3 (37)
- CD14 (36)
- ANAPC11 (34)
- CD33 (34)
- ROR2 (34)
- ANAPC2 (33)
- IL3RA (31)
- MAPK9 (31)
- CD79B (29)
- RORA (28)
- CD3E (26)
- CSF3 (25)
- ANPEP (22)
- ITGB3 (21)
- PTK7 (20)
- FCGR1A (19)
- IL6ST (19)
- MAPK10 (19)
- CD74 (17)
- ROCK2 (17)
- IL2 (16)
- IL6R (16)
- POSTN (16)
- LEF1 (15)
- ROR1 (15)
- IL12B (14)
- CD79A (13)
- TLR8 (13)
- WNT1 (13)
- CD7 (12)
- CEBPB (12)
- ESR2 (12)
- IL36G (12)
- ITGA2B (12)
- TLR2 (12)
- TLR4 (12)
- CASP1 (11)
- FZD4 (11)
- IL1B (11)
- ANAPC5 (10)
- CEBPD (10)
- IL1A (10)
- ROCK1 (10)
- TLR3 (10)
- WNT2B (10)
- WNT3A (10)
- WNT5B (10)
- AGTPBP1 (9)
- FCGR3A (9)
- LRP6 (9)
- CD1A (8)
- FZD2 (8)
- IL10 (8)
- ITGAX (8)
- TCF25 (8)
- WNT10A (8)
- CALR (7)
- FZD1 (7)
- FZD8 (7)
- FZD9 (7)
- HLA-A (7)
- HLA-DRB5 (7)
- IL18 (7)
- IL36A (7)
- LRP5 (7)
- TCF4 (7)
- TCF7L2 (7)
- TLR5 (7)
- TLR6 (7)
- WNT16 (7)
Reactivities
- Human (3054)
- Mouse (1128)
- Rat (880)
- Monkey (108)
- Dog (92)
- Bovine (27)
- Rabbit (17)
- Canine (16)
- Chicken (13)
- Hamster (12)
- Porcine (12)
- Gorilla (10)
- Bat (9)
- Horse (9)
- Gibbon (8)
- Pig (8)
- Canis (5)
- Chimpanzee (5)
- Primate (5)
- Cow (3)
- Xenopus (3)
- Guinea Pig (2)
- C. elegans (1)
- Equine (1)
- Frog (1)
- Macaque (1)
- Opossum (1)
- Orang-Utan (1)
- Rhesus Monkey (1)
- Sheep (1)
- Squirrel (1)
- Tobacco hornworm (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Carrier-free
Knockout (KO) Validation
Modifications
- Unmodified (86)
- Phospho-specific (30)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (14)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (11)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG1 format, for improved compatibility with existing reagents, assays and techniques. (8)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (7)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. (6)
- This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (5)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This is a chimeric antibody created for improved compatibility with existing reagents, assays and techniques. (3)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (3)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG4 (primatized) format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 (primatized) format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This reformatted human antibody was made using the variable domain sequences of the original Human IgG4 (primatized) format, for improved compatibility with existing reagents, assays and techniques. (1)
- Phospho S1490 (1)
- Phospho T183/Y185 (1)
- Phospho T183/Y185,Phospho T221/Y223 (1)
- Phospho T235 (1)
- Phospho Y719 (1)
- This chimeric human antibody was made using the variable domain sequences of the original IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric mouse antibody was made using the variable domain sequences of the original Hamster IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This is a chimeric antibody created for improved compatibility with existing reagents, assays and techniques. (1)
- This is a reformatted human IgG1 antibody based on the therapeutic Fab fragment. NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. (1)
Assay Types
Assay Platforms
Families
- Druggable Genome (2508)
- Transmembrane (1965)
- ES Cell Differentiation/IPS (956)
- Secreted Protein (572)
- Adult stem cells (374)
- Protein Kinase (329)
- Embryonic stem cells (178)
- Transcription Factors (163)
- Stem cell - Pluripotency (135)
- Induced pluripotent stem cells (125)
- Cancer stem cells (95)
- Nuclear Hormone Receptor (94)
- Phosphatase (94)
- Protease (84)
- GPCR (44)
- Stem cell relevant signaling - Wnt Signaling pathway (36)
- Stem cell relevant signaling - JAK/STAT signaling pathway (1)
Pathways
- Hematopoietic cell lineage (1030)
- Cell adhesion molecules (CAMs) (789)
- Pathways in cancer (479)
- T cell receptor signaling pathway (431)
- Wnt signaling pathway (376)
- Cytokine-cytokine receptor interaction (368)
- Primary immunodeficiency (356)
- Melanogenesis (321)
- Toll-like receptor signaling pathway (285)
- Basal cell carcinoma (238)
- Leukocyte transendothelial migration (225)
- Colorectal cancer (221)
- B cell receptor signaling pathway (210)
- MAPK signaling pathway (197)
- Antigen processing and presentation (189)
- NOD-like receptor signaling pathway (185)
- Progesterone-mediated oocyte maturation (185)
- Jak-STAT signaling pathway (175)
- Focal adhesion (152)
- RIG-I-like receptor signaling pathway (144)
- Fc epsilon RI signaling pathway (138)
- Adipocytokine signaling pathway (131)
- Type II diabetes mellitus (127)
- Hedgehog signaling pathway (125)
- Endocytosis (122)
- Fc gamma R-mediated phagocytosis (119)
- ErbB signaling pathway (116)
- Neurotrophin signaling pathway (115)
- Epithelial cell signaling in Helicobacter pylori infection (114)
- Prion diseases (113)
- GnRH signaling pathway (111)
- Insulin signaling pathway (109)
- Graft-versus-host disease (107)
- Pancreatic cancer (107)
- Acute myeloid leukemia (105)
- Regulation of actin cytoskeleton (93)
- Hypertrophic cardiomyopathy (HCM) (80)
- Type I diabetes mellitus (80)
- Oocyte meiosis (79)
- Cell cycle (78)
- Ubiquitin mediated proteolysis (78)
- Allograft rejection (73)
- Alzheimer's disease (72)
- Apoptosis (71)
- Lysosome (70)
- Pathogenic Escherichia coli infection (67)
- Renin-angiotensin system (65)
- Systemic lupus erythematosus (62)
- Cytosolic DNA-sensing pathway (56)
- Complement and coagulation cascades (52)
- Asthma (44)
- Natural killer cell mediated cytotoxicity (44)
- Dilated cardiomyopathy (43)
- Notch signaling pathway (43)
- TGF-beta signaling pathway (43)
- Autoimmune thyroid disease (41)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (36)
- Amyotrophic lateral sclerosis (ALS) (35)
- Chemokine signaling pathway (34)
- Axon guidance (25)
- Vascular smooth muscle contraction (25)
- Endometrial cancer (23)
- Metabolic pathways (23)
- Viral myocarditis (23)
- Glutathione metabolism (21)
- ECM-receptor interaction (20)
- Prostate cancer (20)
- Adherens junction (19)
- Thyroid cancer (17)
- Bladder cancer (8)
- Renal cell carcinoma (8)
- VEGF signaling pathway (7)
- Chronic myeloid leukemia (6)
- Glioma (6)
- Small cell lung cancer (6)
- Non-small cell lung cancer (5)
- Long-term depression (4)
- Long-term potentiation (4)
- Melanoma (4)
- mTOR signaling pathway (4)
- Gap junction (3)
- PPAR signaling pathway (3)
- Tight junction (3)
- Purine metabolism (2)
- Pyrimidine metabolism (2)
- Arginine and proline metabolism (1)
- Dorso-ventral axis formation (1)
- Glycosphingolipid biosynthesis - lacto and neolacto series (1)
- Huntington's disease (1)
- Inositol phosphate metabolism (1)
- Parkinson's disease (1)
- Phosphatidylinositol signaling system (1)
- Vibrio cholerae infection (1)