Osteopontin (SPP1) rabbit polyclonal antibody, Serum
Applications | Assay, ELISA, IHC, IP, WB |
Reactivities | Canine, Human, Mouse, Porcine, Rat |
Immunogen | Synthetic peptide corresponding to Human Osteopontin conjugated to KLH using maleimide. |
Osteopontin (SPP1) rabbit polyclonal antibody, Serum
Applications | Assay, ELISA, IHC, IP, WB |
Reactivities | Canine, Human, Mouse, Porcine, Rat |
Immunogen | Synthetic peptide corresponding to Human Osteopontin conjugated to KLH using maleimide. |
Asialoganglioside GM1 rabbit polyclonal antibody, Ig Fraction
Applications | Assay, CT, FC, FN, IHC, IP |
Reactivities | Mouse, Rat |
Immunogen | Asialo GM1 purified from Bovine brain tissue, methylated BSA and complete Freund's adjuvant. |
DDB2 rabbit polyclonal antibody, Serum
Applications | Assay, ELISA, IP, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide corresponding to amino acids 419-427 of Human DDB2 (C-terminal) coupled to KLH |
Rabbit polyclonal antibody to MCM7 (minichromosome maintenance complex component 7)
Applications | Assay, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 190 and 481 of MCM7 (Uniprot ID#P33993) |
Rabbit Polyclonal GAPDH/G3PDH Antibody
Applications | Assay, IF, IHC, WB |
Reactivities | Human, Mouse, Xenopus |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal region of human GAPDH (between residues 250 and 300)[accession number NP_002037.2] |
ROC1 (RBX1) (C-term) rabbit polyclonal antibody, Serum
Applications | Assay, ELISA, IP, WB |
Reactivities | C. elegans, Human, Mouse, Zebrafish |
Immunogen | Prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 94-108 of Human ROC1 (C-terminal) coupled to KLH. |
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
Applications | Assay, FC, IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
Rabbit polyclonal antibody to PAX8CC (paired box 8)
Applications | Assay, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 204 of PAX8 |
Rabbit Polyclonal antibody to Histone H2A.Z (H2A histone family, member Z)
Applications | Assay, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 65 and 128 of Histone H2A.Z |
Rabbit Polyclonal H3K9me3 Antibody
Applications | Assay, Dot, ELISA, IF, WB |
Reactivities | Human, Mouse |
Immunogen | The immunogen for anti-H3K9me3 antibody: histone H3 containing the trimethylated lysine 9 (H3K9me3), using a KLH-conjugated synthetic peptide. |
HIST4H4 (Citrulline R3) rabbit polyclonal antibody, Serum
Applications | Assay, ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide derived from N-term region of Human Histone H4, containing Citrulline at position 3 |
ATG12 rabbit polyclonal antibody, Purified
Applications | Assay, ELISA, WB |
Reactivities | Saccharomyces cerevisiae, Yeast |
Immunogen | This purified antibody was prepared from rabbit serum after repeated immunizations with recombinant yeast APG12 protein. |
ISG15 rabbit polyclonal antibody, Purified
Applications | Assay, ELISA, WB |
Reactivities | Human |
Immunogen | Recombinant human ISG15 protein |
MTOR pSer2448 rabbit polyclonal antibody, Aff - Purified
Applications | Assay, ELISA, IHC, WB |
Reactivities | Human |
Immunogen | A synthetic peptide corresponding to amino acids 2440-2457 of Human mTOR |
Apc11 (ANAPC11) rabbit polyclonal antibody, Serum
Applications | Assay, ELISA, IP, WB |
Reactivities | Human |
Immunogen | This APC11 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 76-84 of Human APC11 (C-terminal) coupled to KLH. |
Apc2 (ANAPC2) rabbit polyclonal antibody, Serum
Applications | Assay, ELISA, IP, WB |
Reactivities | Human |
Immunogen | This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 810-822 of Human APC2 (C-terminal) coupled to KLH. |
TIP120A (CAND1) rabbit polyclonal antibody, Serum
Applications | Assay, ELISA, IP, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 11-24 of Human CAND1/TIP120A (N-terminal) coupled to KLH. |
TIP120A (CAND1) rabbit polyclonal antibody, Serum
Applications | Assay, ELISA, IP, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 1130-1143 of Human CAND2/TIP120B (C-terminal) coupled to KLH. |
CDC20 (C-term) rabbit polyclonal antibody, Serum
Applications | Assay, ELISA, IP, WB |
Reactivities | Human |
Immunogen | Prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 486-499 of Human CDC20 (fizzy) (C-terminal) coupled to KLH. |
DDB1 rabbit polyclonal antibody, Serum
Applications | Assay, ELISA, IP, WB |
Reactivities | Human, Mouse |
Immunogen | This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 198-213 of Human DDB1 (internal) coupled to KLH. |
PARC (CUL9) rabbit polyclonal antibody, Serum
Applications | Assay, ELISA, IP, WB |
Reactivities | Human, Mouse |
Immunogen | Prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 2503-2517 of Human PARC (C-terminus) coupled to KLH. |
Os04g0627000 (C-term) rabbit polyclonal antibody, Serum
Applications | Assay, ELISA, IP, WB |
Reactivities | C. elegans, Human, Mouse, Zebrafish |
Immunogen | Prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 102-113 of Human ROC2 (C-terminal) coupled to KLH. |
SKP1 (C-term) rabbit polyclonal antibody, Serum
Applications | Assay, ELISA, IP, WB |
Reactivities | Human |
Immunogen | Prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 152-163 of Human SKP1 (C-terminus) coupled to KLH. |
Rabbit Polyclonal antibody to PAD4 (peptidyl arginine deiminase, type IV)
Applications | Assay, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 326 and 611 of PAD4 (Uniprot ID#Q9UM07) |
Rabbit Polyclonal Anti-KLF2 Antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KLF2 antibody: synthetic peptide directed towards the middle region of human KLF2. Synthetic peptide located within the following region: PPAFGLFDDAAAAAAALGLAPPAARGLLTPPASPLELLEAKPKRGRRSWP |
Rabbit Polyclonal HDAC1 Antibody
Applications | Assay, ELISA, IF, WB |
Reactivities | Human |
Immunogen | The immunogen for anti-HDAC1 antibody: the C-terminal region of human HDAC1 (Histone deacetylase 1), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal H3K4me3 Antibody
Applications | Assay, Dot, ELISA, WB |
Reactivities | Human |
Immunogen | The immunogen for anti-H3K4me3 antibody: the region of histone H3 containing the trimethylated lysine 4 (H3K4me3), using a KLH-conjugated synthetic peptide. |
RAD54 (RAD54L) (1-17) rabbit polyclonal antibody, Aff - Purified
Applications | Assay, ELISA, WB |
Reactivities | Human |
Immunogen | Synthetic peptide corresponding aa 1-17 of Human RAD54 protein. |
swi6 (314-328) rabbit polyclonal antibody, Aff - Purified
Applications | Assay, ELISA, WB |
Reactivities | Yeast |
Immunogen | Synthetic peptide corresponding aa 314-328 of S.pombe Swi6 protein |
MTOR (2440-2457) rabbit polyclonal antibody, Aff - Purified
Applications | Assay, ELISA, WB |
Reactivities | Canine, Human, Mouse, Zebrafish |
Immunogen | Synthetic peptide corresponding to amino acids 2440-2457 of human mTOR |
Thy1 rabbit polyclonal antibody, Serum
Applications | Assay, CT, IHC |
Reactivities | Mouse |
Immunogen | CBA Brain. |
Thy1 rabbit polyclonal antibody, Serum
Applications | Assay, CT, IHC |
Reactivities | Mouse |
Immunogen | CBA Brain. |
ATG8 rabbit polyclonal antibody, Purified
Applications | Assay, ELISA, WB |
Reactivities | Yeast |
Immunogen | This purified antibody was prepared from rabbit serum after repeated immunizations with recombinant yeast APG8 protein. |
HUB1 rabbit polyclonal antibody, Purified
Applications | Assay, ELISA, WB |
Reactivities | Yeast |
Immunogen | This purified antibody was prepared from rabbit serum after repeated immunizations with recombinant yeast Hub1 protein. |
URM1 rabbit polyclonal antibody, Purified
Applications | Assay, ELISA, WB |
Reactivities | Yeast |
Immunogen | Recombinant yeast Urm1 protein. |
RAD9A pSer1260 rabbit polyclonal antibody, Aff - Purified
Applications | Assay, ELISA, WB |
Reactivities | Yeast |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to phosphorylated form of aa 1249-1263 of 1309 of yeast Rad9 protein conjugated to KLH. |
RAD9A pSer1129 rabbit polyclonal antibody, Aff - Purified
Applications | Assay, ELISA, WB |
Reactivities | Yeast |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to phosphorylated form of aa 1125-1139 of 1309 of yeast Rad9 protein conjugated to KLH. |
RAD9A pSer1129 rabbit polyclonal antibody, Aff - Purified
Applications | Assay, ELISA, WB |
Reactivities | Yeast |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to aa 1125-1139 of 1309 of yeast Rad9 protein conjugated to KLH. |
ZNF148 rabbit polyclonal antibody, Serum
Applications | Assay, ELISA, WB |
Reactivities | Human |
Immunogen | Purified full length ZBP-89 recombinant protein expressed in E.coli |
Glycogen synthase 1 (GYS1) pSer641 rabbit polyclonal antibody, Aff - Purified
Applications | Assay, ELISA, WB |
Reactivities | Human, Mouse |
Immunogen | Human Muscle Glycogen Synthase phospho peptide corresponding to a region of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Aurora B (AURKB) rabbit polyclonal antibody, Aff - Purified
Applications | Assay, ELISA, WB |
Reactivities | Human |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding aa 227-238 of Human Aurora Kinase B protein. |
Rabbit Polyclonal anti-TP53 antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal anti-TP53 antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal Anti-HDAC2 Antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HDAC2 antibody: synthetic peptide directed towards the middle region of human HDAC2. Synthetic peptide located within the following region: HKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSN |
Rabbit Polyclonal Anti-JUN Antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-JUN antibody: synthetic peptide directed towards the N terminal of human JUN. Synthetic peptide located within the following region: TAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKP |
Rabbit Polyclonal Anti-TAF1 Antibody
Applications | Assay, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TAF1 antibody: synthetic peptide directed towards the C terminal of human TAF1. Synthetic peptide located within the following region: YEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE |
Rabbit Polyclonal Anti-SUZ12 Antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SUZ12 antibody: synthetic peptide directed towards the middle region of human SUZ12. Synthetic peptide located within the following region: TGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQ |
Rabbit Polyclonal Anti-HDAC2 Antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HDAC2 antibody: synthetic peptide directed towards the middle region of human HDAC2. Synthetic peptide located within the following region: HKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSN |
Rabbit Polyclonal Anti-MED17 Antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CRSP6 Antibody: synthetic peptide directed towards the N terminal of human CRSP6. Synthetic peptide located within the following region: AAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILG |
Rabbit Polyclonal Anti-SMARCA1 Antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SMARCA1 Antibody: synthetic peptide directed towards the N terminal of human SMARCA1. Synthetic peptide located within the following region: EQDTAAVAATVAAADATATIVVIEDEQPGPSTSQEEGAAAAATEATAATE |