Products

View as table Download

Osteopontin (SPP1) rabbit polyclonal antibody, Serum

Applications Assay, ELISA, IHC, IP, WB
Reactivities Canine, Human, Mouse, Porcine, Rat
Immunogen Synthetic peptide corresponding to Human Osteopontin conjugated to KLH using maleimide.

Asialoganglioside GM1 rabbit polyclonal antibody, Ig Fraction

Applications Assay, CT, FC, FN, IHC, IP
Reactivities Mouse, Rat
Immunogen Asialo GM1 purified from Bovine brain tissue, methylated BSA and complete Freund's adjuvant.

DDB2 rabbit polyclonal antibody, Serum

Applications Assay, ELISA, IP, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide corresponding to amino acids 419-427 of Human DDB2 (C-terminal) coupled to KLH

Rabbit polyclonal antibody to MCM7 (minichromosome maintenance complex component 7)

Applications Assay, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 190 and 481 of MCM7 (Uniprot ID#P33993)

Rabbit Polyclonal GAPDH/G3PDH Antibody

Applications Assay, IF, IHC, WB
Reactivities Human, Mouse, Xenopus
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal region of human GAPDH (between residues 250 and 300)[accession number NP_002037.2]

ROC1 (RBX1) (C-term) rabbit polyclonal antibody, Serum

Applications Assay, ELISA, IP, WB
Reactivities C. elegans, Human, Mouse, Zebrafish
Immunogen Prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 94-108 of Human ROC1 (C-terminal) coupled to KLH.

Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))

Applications Assay, FC, IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106)

Rabbit polyclonal antibody to PAX8CC (paired box 8)

Applications Assay, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 204 of PAX8

Rabbit Polyclonal antibody to Histone H2A.Z (H2A histone family, member Z)

Applications Assay, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide contain a sequence corresponding to a region within amino acids 65 and 128 of Histone H2A.Z

Rabbit Polyclonal H3K9me3 Antibody

Applications Assay, Dot, ELISA, IF, WB
Reactivities Human, Mouse
Immunogen The immunogen for anti-H3K9me3 antibody: histone H3 containing the trimethylated lysine 9 (H3K9me3), using a KLH-conjugated synthetic peptide.

HIST4H4 (Citrulline R3) rabbit polyclonal antibody, Serum

Applications Assay, ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide derived from N-term region of Human Histone H4, containing Citrulline at position 3

ATG12 rabbit polyclonal antibody, Purified

Applications Assay, ELISA, WB
Reactivities Saccharomyces cerevisiae, Yeast
Immunogen This purified antibody was prepared from rabbit serum after repeated immunizations with recombinant yeast APG12 protein.

ISG15 rabbit polyclonal antibody, Purified

Applications Assay, ELISA, WB
Reactivities Human
Immunogen Recombinant human ISG15 protein

MTOR pSer2448 rabbit polyclonal antibody, Aff - Purified

Applications Assay, ELISA, IHC, WB
Reactivities Human
Immunogen A synthetic peptide corresponding to amino acids 2440-2457 of Human mTOR

Apc11 (ANAPC11) rabbit polyclonal antibody, Serum

Applications Assay, ELISA, IP, WB
Reactivities Human
Immunogen This APC11 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 76-84 of Human APC11 (C-terminal) coupled to KLH.

Apc2 (ANAPC2) rabbit polyclonal antibody, Serum

Applications Assay, ELISA, IP, WB
Reactivities Human
Immunogen This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 810-822 of Human APC2 (C-terminal) coupled to KLH.

TIP120A (CAND1) rabbit polyclonal antibody, Serum

Applications Assay, ELISA, IP, WB
Reactivities Human, Mouse, Rat
Immunogen This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 11-24 of Human CAND1/TIP120A (N-terminal) coupled to KLH.

TIP120A (CAND1) rabbit polyclonal antibody, Serum

Applications Assay, ELISA, IP, WB
Reactivities Human, Mouse, Rat
Immunogen This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 1130-1143 of Human CAND2/TIP120B (C-terminal) coupled to KLH.

CDC20 (C-term) rabbit polyclonal antibody, Serum

Applications Assay, ELISA, IP, WB
Reactivities Human
Immunogen Prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 486-499 of Human CDC20 (fizzy) (C-terminal) coupled to KLH.

DDB1 rabbit polyclonal antibody, Serum

Applications Assay, ELISA, IP, WB
Reactivities Human, Mouse
Immunogen This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 198-213 of Human DDB1 (internal) coupled to KLH.

PARC (CUL9) rabbit polyclonal antibody, Serum

Applications Assay, ELISA, IP, WB
Reactivities Human, Mouse
Immunogen Prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 2503-2517 of Human PARC (C-terminus) coupled to KLH.

Os04g0627000 (C-term) rabbit polyclonal antibody, Serum

Applications Assay, ELISA, IP, WB
Reactivities C. elegans, Human, Mouse, Zebrafish
Immunogen Prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 102-113 of Human ROC2 (C-terminal) coupled to KLH.

SKP1 (C-term) rabbit polyclonal antibody, Serum

Applications Assay, ELISA, IP, WB
Reactivities Human
Immunogen Prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 152-163 of Human SKP1 (C-terminus) coupled to KLH.

Rabbit Polyclonal antibody to PAD4 (peptidyl arginine deiminase, type IV)

Applications Assay, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 326 and 611 of PAD4 (Uniprot ID#Q9UM07)

Rabbit Polyclonal Anti-KLF2 Antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KLF2 antibody: synthetic peptide directed towards the middle region of human KLF2. Synthetic peptide located within the following region: PPAFGLFDDAAAAAAALGLAPPAARGLLTPPASPLELLEAKPKRGRRSWP

Rabbit Polyclonal HDAC1 Antibody

Applications Assay, ELISA, IF, WB
Reactivities Human
Immunogen The immunogen for anti-HDAC1 antibody: the C-terminal region of human HDAC1 (Histone deacetylase 1), using a KLH-conjugated synthetic peptide.

Rabbit Polyclonal H3K4me3 Antibody

Applications Assay, Dot, ELISA, WB
Reactivities Human
Immunogen The immunogen for anti-H3K4me3 antibody: the region of histone H3 containing the trimethylated lysine 4 (H3K4me3), using a KLH-conjugated synthetic peptide.

RAD54 (RAD54L) (1-17) rabbit polyclonal antibody, Aff - Purified

Applications Assay, ELISA, WB
Reactivities Human
Immunogen Synthetic peptide corresponding aa 1-17 of Human RAD54 protein.

swi6 (314-328) rabbit polyclonal antibody, Aff - Purified

Applications Assay, ELISA, WB
Reactivities Yeast
Immunogen Synthetic peptide corresponding aa 314-328 of S.pombe Swi6 protein

MTOR (2440-2457) rabbit polyclonal antibody, Aff - Purified

Applications Assay, ELISA, WB
Reactivities Canine, Human, Mouse, Zebrafish
Immunogen Synthetic peptide corresponding to amino acids 2440-2457 of human mTOR

Thy1 rabbit polyclonal antibody, Serum

Applications Assay, CT, IHC
Reactivities Mouse
Immunogen CBA Brain.

Thy1 rabbit polyclonal antibody, Serum

Applications Assay, CT, IHC
Reactivities Mouse
Immunogen CBA Brain.

ATG8 rabbit polyclonal antibody, Purified

Applications Assay, ELISA, WB
Reactivities Yeast
Immunogen This purified antibody was prepared from rabbit serum after repeated immunizations with recombinant yeast APG8 protein.

HUB1 rabbit polyclonal antibody, Purified

Applications Assay, ELISA, WB
Reactivities Yeast
Immunogen This purified antibody was prepared from rabbit serum after repeated immunizations with recombinant yeast Hub1 protein.

URM1 rabbit polyclonal antibody, Purified

Applications Assay, ELISA, WB
Reactivities Yeast
Immunogen Recombinant yeast Urm1 protein.

RAD9A pSer1260 rabbit polyclonal antibody, Aff - Purified

Applications Assay, ELISA, WB
Reactivities Yeast
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to phosphorylated form of aa 1249-1263 of 1309 of yeast Rad9 protein conjugated to KLH.

RAD9A pSer1129 rabbit polyclonal antibody, Aff - Purified

Applications Assay, ELISA, WB
Reactivities Yeast
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to phosphorylated form of aa 1125-1139 of 1309 of yeast Rad9 protein conjugated to KLH.

RAD9A pSer1129 rabbit polyclonal antibody, Aff - Purified

Applications Assay, ELISA, WB
Reactivities Yeast
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to aa 1125-1139 of 1309 of yeast Rad9 protein conjugated to KLH.

ZNF148 rabbit polyclonal antibody, Serum

Applications Assay, ELISA, WB
Reactivities Human
Immunogen Purified full length ZBP-89 recombinant protein expressed in E.coli

Glycogen synthase 1 (GYS1) pSer641 rabbit polyclonal antibody, Aff - Purified

Applications Assay, ELISA, WB
Reactivities Human, Mouse
Immunogen Human Muscle Glycogen Synthase phospho peptide corresponding to a region of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH).

Aurora B (AURKB) rabbit polyclonal antibody, Aff - Purified

Applications Assay, ELISA, WB
Reactivities Human
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding aa 227-238 of Human Aurora Kinase B protein.

Rabbit Polyclonal anti-TP53 antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE

Rabbit Polyclonal anti-TP53 antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE

Rabbit Polyclonal Anti-HDAC2 Antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HDAC2 antibody: synthetic peptide directed towards the middle region of human HDAC2. Synthetic peptide located within the following region: HKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSN

Rabbit Polyclonal Anti-JUN Antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-JUN antibody: synthetic peptide directed towards the N terminal of human JUN. Synthetic peptide located within the following region: TAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKP

Rabbit Polyclonal Anti-TAF1 Antibody

Applications Assay, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TAF1 antibody: synthetic peptide directed towards the C terminal of human TAF1. Synthetic peptide located within the following region: YEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE

Rabbit Polyclonal Anti-SUZ12 Antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SUZ12 antibody: synthetic peptide directed towards the middle region of human SUZ12. Synthetic peptide located within the following region: TGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQ

Rabbit Polyclonal Anti-HDAC2 Antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HDAC2 antibody: synthetic peptide directed towards the middle region of human HDAC2. Synthetic peptide located within the following region: HKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSN

Rabbit Polyclonal Anti-MED17 Antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CRSP6 Antibody: synthetic peptide directed towards the N terminal of human CRSP6. Synthetic peptide located within the following region: AAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILG

Rabbit Polyclonal Anti-SMARCA1 Antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SMARCA1 Antibody: synthetic peptide directed towards the N terminal of human SMARCA1. Synthetic peptide located within the following region: EQDTAAVAATVAAADATATIVVIEDEQPGPSTSQEEGAAAAATEATAATE