Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Anti-NOTCH2 (Cleaved-Ala1734) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NOTCH2 (Cleaved-Ala1734) Antibody: A synthesized peptide derived from human NOTCH2 (Cleaved-Ala1734) |
Rabbit polyclonal SOS2 Antibody (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SOS2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 188-215 amino acids from the N-terminal region of human SOS2. |
Rabbit Polyclonal Anti-PIWIL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIWIL2 antibody: synthetic peptide directed towards the N terminal of human PIWIL2. Synthetic peptide located within the following region: QVLELKSQRKTDSAEISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDM |
Rabbit anti-GRB2 Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GRB2 |
Rabbit Polyclonal Anti-Notch 2 (Cleaved-Asp1733) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Notch 2 (Cleaved-Asp1733) Antibody: A synthesized peptide derived from human Notch 2 (Cleaved-Asp1733) |
USD 530.00
2 Weeks
EGFR Non pTyr1197 (incl. pos. control) mouse monoclonal antibody, clone 20G3, Biotin
| Applications | ELISA, IF, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
MEK1 (MAP2K1) (N-term) rabbit polyclonal antibody, Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Xenopus |
| Immunogen | MAP2K1 antibody was raised against synthetic peptide derived from sequence near the amino-terminus of human MEK1, conjugated to KLH |
Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human: Thr693, Mouse: Thr695, Rat: Thr694 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal ETV6 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ETV6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 84-111 amino acids from the N-terminal region of human ETV6. |
Rabbit Polyclonal ERK1/2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ERK1/2 |
Rabbit Polyclonal ERK1/2 (Thr202/Tyr204) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ERK1/2 around the phosphorylation site of Threonine 202/Tyrosine 204 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-PIWIL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIWIL1 antibody: synthetic peptide directed towards the N terminal of human PIWIL1. Synthetic peptide located within the following region: FQELSLAERGGRRRDFHDLGVNTRQNLDHVKESKTGSSGIIVRLSTNHFR |
Rabbit Polyclonal Anti-PIWIL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIWIL1 antibody: synthetic peptide directed towards the middle region of human PIWIL1. Synthetic peptide located within the following region: LTYKLCHIYYNWPGVIRVPAPCQYAHKLAFLVGQSIHREPNLSLSNRLYY |
Rabbit Polyclonal Anti-EGFR Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGFR Antibody: A synthesized peptide derived from human EGFR |
Rabbit Polyclonal Anti-MAPK1/3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAPK1/3 Antibody: A synthesized peptide derived from human MAPK1/3 |
Rabbit Polyclonal Anti-SOS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOS2 Antibody: A synthesized peptide derived from human SOS2 |
Rabbit Polyclonal Anti-Notch 1 (Cleaved-Val1744) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Notch 1 (Cleaved-Val1744) Antibody: A synthesized peptide derived from human Notch 1 (Cleaved-Val1744) |
Rabbit Polyclonal Anti-QSOX1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | QSOX1 antibody was raised against a 17 amino acid peptide near the center of human QSOX1. |
Goat Polyclonal Anti-ERBB1 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,162 aa to the C-terminus of human ERBB1 produced in E. coli. |
USD 530.00
2 Weeks
EGFR pTyr1069 (incl. pos. control) mouse monoclonal antibody, clone 11C2, Biotin
| Applications | ELISA, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Biotin |
USD 465.00
2 Weeks
ERK2 (MAPK1) (C-term) (incl. pos. control) mouse monoclonal antibody, clone 6G11, Biotin
| Applications | ELISA, IP, WB |
| Reactivities | Canine, Human, Mouse, Rat |
| Conjugation | Biotin |
SPIRE2 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 285-313 amino acids from the Central region of Human SPIRE2. |
Rabbit Polyclonal Antibody against MAP2K1 (S217)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MEK1(MAP2K1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 196-225 amino acids from human MEK1(MAP2K1). |
Germany
Japan
United Kingdom
China
