Products

View as table Download

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.

Rabbit polyclonal HLA-G Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HLA-G antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the Central region of human HLA-G.

Rabbit Polyclonal IL-1 beta/IL-1F2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to a C-terminal portion of the human IL 1 beta protein (between amino acids 100-200) [UniProt P01584]

Rabbit Polyclonal Anti-CPE Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CPE antibody: synthetic peptide directed towards the N terminal of human CPE. Synthetic peptide located within the following region: GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG

Rabbit Polyclonal Anti-IFNG Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human IFNG

Rabbit Polyclonal Anti-IL1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human IL1A

Rabbit anti-HLA-A Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human HLA-A

Rabbit Polyclonal antibody to GAD65 (glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa))

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 353 and 585 of GAD65 (Uniprot ID#Q05329)

CD86 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CD86

Rabbit anti-GZMB Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GZMB

Rabbit Polyclonal Anti-Insulin Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Insulin Antibody: A synthesized peptide derived from human Insulin

Rabbit Polyclonal Anti-IL-12A Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-12A antibody was raised against an 18 amino acid peptide near the carboxy terminus of human IL-12A. The immunogen is located within the last 50 amino acids of IL-12A.

Rabbit Polyclonal antibody to GAD67 (glutamate decarboxylase 1 (brain, 67kDa))

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 5 and 216 of GAD67 (Uniprot ID#Q99259)

Rabbit anti-HLA-DPB1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human HLA-DPB1

Rabbit Polyclonal Anti-Interleukin 12A Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Interleukin 12A Antibody: A synthesized peptide derived from human Interleukin 12A

IL1 beta (IL1B) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 131-180 of Human IL-1 Beta

Rabbit polyclonal anti-GAD67/GAD1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human GAD67.
Modifications Phospho-specific

PRF1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRF1

Rabbit anti-HSPD1 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HSPD1

IL12A mouse monoclonal antibody, Azide Free

Applications ELISA, IF, WB
Reactivities Human

Rabbit polyclonal Granzyme B antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Granzyme B.

Anti-HLA-DRA Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 26-216 amino acids of human major histocompatibility complex, class II, DR alpha

Mouse monoclonal Hsp60 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Chicken, Guinea Pig, Hamster, Monkey, Pig, Rabbit, Spinach, E.coli (GroEl), H. pylori, S. typhimurium, T. spiralis, yeast, white fly
Conjugation Unconjugated

Rabbit Polyclonal Anti-DEPTOR Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DEPTOR antibody was raised against a 16 amino acid peptide near the center of human DEPTOR.

CD28 mouse monoclonal antibody, clone CD28.2, Azide Free

Applications FC, FN, IF, IHC, IP, WB
Reactivities Human, Primate

CD28 mouse monoclonal antibody, clone CD28.2, Purified

Applications FC, FN, IF, IHC, IP, WB
Reactivities Human, Primate

IL12A (alpha + beta) goat polyclonal antibody, Aff - Purified

Applications ELISA, FN, WB
Reactivities Human
Immunogen Highly pure (>98%) recombinant hIL-12 (human Interleukin-12)

Rabbit polyclonal anti-IL-2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-2 antibody was prepared from whole rabbit serum produced by repeated immunizations with full length recombinant human IL-2 protein.

IL2 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human IL2

HLA-DRA Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HLA-DRA

IL1A Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human IL1A

Hsp60 (HSPD1) goat polyclonal antibody, Purified

Applications IHC, IP, WB
Reactivities Bacteria, Bovine, Canine, Drosophila, Fish, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep, Xenopus
Immunogen HSPD1 antibody was raised against recombinant human HSP60.

GAD67 (GAD1) chicken polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide KLH conjugated corresponding to a region near the C-terminus of this gene product, and was 100% conserved between the Human (Q99259), Mouse (P48318) and Rat (NP_058703) gene products.
After repeated injections into the hens, immune eggs were collected, and the IgY fractions were purified from the yolks. These IgY fractions were then affinity purified using a peptide column.

Rabbit polyclonal anti-HSP60 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human HSP60.

Rabbit polyclonal anti-HSPD1(HSP60) antibody(Center), Loading control

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HSPD1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 187-215 amino acids from the Central region of human HSPD1.

Rabbit Polyclonal Anti-PRF1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRF1 antibody: synthetic peptide directed towards the N terminal of human PRF1. Synthetic peptide located within the following region: SVAGSHSQAANFAAQKTHQDQYSFSTDTVECRFYSFHVVHTPPLHPDFKR

Rabbit Polyclonal Anti-FASL Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FASL Antibody: A synthesized peptide derived from human FASL

Rabbit Polyclonal Anti-Interleukin 1β Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Interleukin 1β Antibody: A synthesized peptide derived from human Interleukin 1β

Rabbit Polyclonal Anti-Interleukin 2 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Interleukin 2 Antibody: A synthesized peptide derived from human Interleukin 2

GAD67 (GAD1) (526-537) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Immunogen Synthetic peptide from an internal region of human GAD1 / GAD67 (NP_000808.2)

GAD65 (GAD2) (515-528) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Monkey, Mouse
Immunogen Synthetic peptide from an internal region of human GAD2

Hsp60 (HSPD1) rabbit polyclonal antibody

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Hsp60 (HSPD1) rabbit polyclonal antibody

Applications FC, IF, IHC, WB
Reactivities Mouse, Primate, Rat
Conjugation Unconjugated

IL1 beta (IL1B) rabbit polyclonal antibody, Azide Free

Applications ELISA, FN, WB
Reactivities Chicken
Immunogen Recombinaint Chicken IL-1B

Rabbit polyclonal anti-FAS antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human Fas.

Rabbit polyclonal FAS ligand antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FAS ligand.

Rabbit polyclonal anti-HLA-DOB antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human HLA-DOB.

FAS Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human FAS

Rabbit anti-IL1B Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human IL1B