Germany
Japan
United Kingdom
China
Products
USD 475.00
5 Days
Insulin (INS) (+Proinsulin) mouse monoclonal antibody, clone D3E7 (5B6/6), Purified
| Applications | ELISA, IHC |
| Reactivities | Bovine, Human, Mouse, Porcine, Rat |
FAS Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FAS |
Goat Polyclonal Anti-INS Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant human Insulin produced in E. coli as a fusion protein. |
USD 475.00
5 Days
Insulin (INS) (+Proinsulin) mouse monoclonal antibody, clone 5E4/3 (D6C4), Purified
| Applications | ELISA, IHC |
| Reactivities | Bovine, Human, Mouse, Porcine, Rat |
Mouse Anti-Human CD95 (APO-1/Fas) Purified
| Applications | FC |
| Reactivities | Human |
Insulin (INS) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Bovine, Porcine, Rat |
| Conjugation | Unconjugated |
Insulin (INS) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Insulin (INS) (+Proinsulin) guinea pig polyclonal antibody, Serum
| Applications | IF, IHC |
| Reactivities | Hamster, Human, Porcine, Rat |
| Immunogen | Synthetic Human proinsulin |
Insulin (INS) (+Proinsulin) mouse monoclonal antibody, clone 3A6
| Applications | ELISA |
| Reactivities | Bovine, Human, Porcine |
| Conjugation | Unconjugated |
Insulin (INS) (+Proinsulin) mouse monoclonal antibody, clone 7F8
| Applications | ELISA |
| Conjugation | Unconjugated |
Insulin (INS) (+Proinsulin) mouse monoclonal antibody, clone 8E2
| Applications | ELISA |
| Reactivities | Bovine, Human, Porcine |
| Conjugation | Unconjugated |
Insulin (INS) (beta chain) mouse monoclonal antibody, clone C7C9
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Insulin (INS) mouse monoclonal antibody, clone ISL-8J, Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
USD 630.00
2 Weeks
Insulin (INS) (+Proinsulin) (C-term) mouse monoclonal antibody, clone INSC7C9, Purified
| Applications | ELISA |
| Reactivities | Human |
CD95 (FAS) (Center) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | conjugated synthetic peptide selected from the Center region of human FAS |
CD95 (FAS) (323-327) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Peptide sequence around aa.323~327 derived from human Fas . |
CD95 (FAS) (323-327) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Peptide sequence around aa.323~327 derived from human Fas . |
Insulin (INS) sheep polyclonal antibody, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Immunogen | C-Peptide conjugate EAEDLQVGQVKKKC- KLH |
Insulin (INS) sheep polyclonal antibody, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Immunogen | C-Peptide conjugate EAEDLQVGQVKKKC- KLH |
Goat Anti-FAS / CD95 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KTCRKHRKENQGSH, from the internal region of the protein sequence according to NP_000034.1; NP_690610.1; NP_690611.1. |
Rabbit Polyclonal Anti-FAIM2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAIM2 antibody is: synthetic peptide directed towards the N-terminal region of Human FAIM2. Synthetic peptide located within the following region: QVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVPLHPSWAYVD |
Mouse Monoclonal FAS (C-terminus) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Mouse anti Insulin Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human, Rat, Pig |
| Conjugation | Unconjugated |
Rabbit anti CD95 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FAS mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) FAS mouse monoclonal antibody, clone OTI2C2 (formerly 2C2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SMURF2 mouse monoclonal antibody, clone OTI6E12 (formerly 6E12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) SMURF2 mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-INS Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human INS |
FAS mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FAS mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FAS mouse monoclonal antibody, clone OTI2C2 (formerly 2C2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
FAS mouse monoclonal antibody, clone OTI2C2 (formerly 2C2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
SMURF2 mouse monoclonal antibody, clone OTI6E12 (formerly 6E12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
SMURF2 mouse monoclonal antibody, clone OTI6E12 (formerly 6E12), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
SMURF2 mouse monoclonal antibody, clone OTI6E12 (formerly 6E12), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
SMURF2 mouse monoclonal antibody, clone OTI6E12 (formerly 6E12)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
SMURF2 mouse monoclonal antibody, clone OTI5E4 (formerly 5E4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
SMURF2 mouse monoclonal antibody, clone OTI5E4 (formerly 5E4), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
SMURF2 mouse monoclonal antibody, clone OTI5E4 (formerly 5E4), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
Active filters
Category
-
- Antibodies
-
Families
- ES Cell Differentiation/IPS
Pathways
- Type I diabetes mellitus