Products

View as table Download

Rabbit anti-PPP1CB Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP1CB

PPP3CA Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP3CA

Rabbit Polyclonal Anti-PPP1CA Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP1CA antibody: synthetic peptide directed towards the N terminal of human PPP1CA. Synthetic peptide located within the following region: MSDSEKLNLDSIIGRLLEGSRVLTPHCAPVQGSRPGKNVQLTENEIRGLC

Rabbit Polyclonal Anti-PPP2R5A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP2R5A antibody: synthetic peptide directed towards the N terminal of human PPP2R5A. Synthetic peptide located within the following region: YVSTNRGVIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASW

Rabbit Polyclonal antibody to PP1C gamma (protein phosphatase 1, catalytic subunit, gamma isozyme)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 2 and 227 of PP1C gamma (Uniprot ID#P36873)

Rabbit anti-PPP1CA Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP1CA

Rabbit monoclonal antibody against Cdc25C(E302)

Applications FC, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

CDC25C Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CDC25C

Rabbit anti-PPP2R1A Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP2R1A

Rabbit Polyclonal Anti-PPP2R5E Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ppp2r5e antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: SCNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEFQP

PPP3R2 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 9~29 amino acids from the N-terminal region of Human PPP3R2 / CBLP

Goat Polyclonal Antibody against B56 beta isoform

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QRLTPQVAASGGQS, from the C Terminus of the protein sequence according to NP_006235.1.

Rabbit Polyclonal Anti-PPP2R1B Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP2R1B antibody: synthetic peptide directed towards the N terminal of human PPP2R1B. Synthetic peptide located within the following region: EDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALAEQ

Rabbit Polyclonal Anti-PPP2R1A Antibody - N-terminal region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-PPP2R1A antibody is: synthetic peptide directed towards the N-terminal region of HUMAN PPP2R1A. Synthetic peptide located within the following region: IDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVL

Rabbit Polyclonal Anti-PPP2R5D Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP2R5D antibody: synthetic peptide directed towards the middle region of human PPP2R5D. Synthetic peptide located within the following region: ETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEA

Rabbit Polyclonal Anti-PPP2R5C Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP2R5C antibody: synthetic peptide directed towards the middle region of human PPP2R5C. Synthetic peptide located within the following region: RFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGK

Rabbit Polyclonal Anti-Ppp3cb Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Ppp3cb antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRI

Rabbit Polyclonal Anti-Ppp3cb Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Ppp3cb antibody is: synthetic peptide directed towards the middle region of Rat Ppp3cb. Synthetic peptide located within the following region: MCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS

Rabbit Polyclonal Anti-PPP2R1A Antibody - middle region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP2R1A antibody: synthetic peptide directed towards the middle region of human PPP2R1A. Synthetic peptide located within the following region: NVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSL

Rabbit Polyclonal Anti-PPP2R5E Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP2R5E antibody: synthetic peptide directed towards the N terminal of human PPP2R5E. Synthetic peptide located within the following region: QFRSQGKPIELTPLPLLKDVPSSEQPELFLKKLQQCCVIFDFMDTLSDLK

PPP2R1A mouse monoclonal antibody, clone 4E6, Purified

Applications ELISA, IHC, WB
Reactivities Human

PP2A-alpha (PPP2CA) (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide peptide between 1~30 amino acids from the N-terminal region of Human PPP2CA/B.

PP2A-alpha (PPP2CA) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a sequence mapping near the N-terminal of human PP2A

Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298)

Rabbit polyclonal CDC25C (Ser198) antibody(Phospho-specific)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CDC25C around the phosphorylation site of serine 198 (E-F-SP-L-K).
Modifications Phospho-specific

Rabbit polyclonal anti-PPP2R5A antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PPP2R5A.

Anti-CDC25C Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around aa.214~218 (S-P-S-M-P) derived from Human cdc25C.

Rabbit Polyclonal CDC25C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CDC25C

Rabbit Polyclonal CDC25C (Ser216) Antibody (Phospho-specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CDC25C around the phosphorylation site of Serine 216
Modifications Phospho-specific

Mouse Monoclonal PPP1A Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Cdc25C Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Calcineurin A (PPP3CA) mouse monoclonal antibody, clone CC-6, Aff - Purified

Applications IHC, WB
Reactivities Human, Rat

PP1C gamma (PPP1CC) rabbit polyclonal antibody, Purified

Applications IP, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen A KLH conjugated peptide corresponding to the C-terminal region (311-323) of PP1 gamma 1 catalytic subunit.

PP1C gamma (PPP1CC) sheep polyclonal antibody, Purified

Applications IP, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen A peptide conjugated to KLH

PPP2R1A rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen A peptide conjugated to KLH

PPP2R1A sheep polyclonal antibody, Purified

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen A peptide conjugated to KLH corresponding to amino acids 7-19 sequence (N-terminal) of PP2A/A regulatory subunit having a MW of 65kD

PPP2R1B rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen A peptide conjugated to KLH

PPP2R1B sheep polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen The immunogen used to the purified peptide conjugated to KLH corresponding to the sequence NH2-Phe-Ser-Gln-Val-Lys-Gly-Ala-Val-Asp-Asp-Asp-Val-Ala-Glu-COOH. This peptide antibody corresponds to N -terminal peptide of PP2A/B a regulatory subunit having a MW of 55kD.

PP2A-alpha (PPP2CA) sheep polyclonal antibody, Purified

Applications IP, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen A peptide conjugated to KLH

Calcineurin A (PPP3CA) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen A peptide conjugated to KLH

Calcineurin A (PPP3CA) sheep polyclonal antibody, Purified

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen A purified peptide conjugated to KLH

PPP1A (PPP1CA) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

Calcineurin A (PPP3CA) (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 21-51 amino acids from the N-terminal region of human Calcineurin (PPP3CA).

PPP3CC (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen kLH conjugated synthetic peptide selected from the N-terminal region of Human PPP3CC. 
Epitope: N-Terminus.

PPP3CC (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 17-45 amino acids from the N-terminal region of Human PPP3CC

Goat Anti-PP2A / PPP2R1A Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-KYFAQEALTVLSLA, from the C Terminus of the protein sequence according to NP_055040.2.

Rabbit polyclonal anti-PPP2R1B antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PPP2R1B.

Rabbit polyclonal anti-Calcineurin A antibody

Applications WB
Reactivities Bovine, Hamster, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to residues surrounding amino acids 267 of human Calcineurin A

Rabbit polyclonal Protein Phosphatase 1 beta (PPP1CB) Antibody (C-term)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This Protein Phosphatase 1 beta (PPP1CB) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 286-315 amino acids from the C-terminal region of human Protein Phosphatase 1 beta (PPP1CB).