Germany
Japan
United Kingdom
China
Products
Chicken Polyclonal Anti-GAPDH Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GAPDH antibody was raised against a 16 amino acid synthetic peptide from near the carboxy terminus of human GAPDH. The immunogen is located within amino acids 230 - 280 of GAPDH. |
Rabbit polyclonal CDK5 (Ab-15) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CDK5 around the phosphorylation site of tyrosine 15 (G-T-YP-G-T) |
Rabbit Polyclonal Anti-UCRC Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK |
Rabbit Polyclonal GAPDH/G3PDH Antibody
| Applications | Assay, IF, IHC, WB |
| Reactivities | Human, Mouse, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal region of human GAPDH (between residues 250 and 300)[accession number NP_002037.2] |
Rabbit Polyclonal Anti-LRP1 Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LRP1 antibody: synthetic peptide directed towards the middle region of human LRP1. Synthetic peptide located within the following region: ATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCAR |
Goat Polyclonal Antibody against APOE
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-VGTSAAPVPSDNH, from the C Terminus of the protein sequence according to NP_000032.1. |
Goat Anti-ERN1 / IRE1a Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-PNAHGKIKAMISD, from the internal region of the protein sequence according to NP_001424.3. |
Rabbit polyclonal anti-NDUFA4L2 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NDUFA4L2. |
Rabbit Polyclonal Anti-ATP2A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Macaque |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP2A1 antibody: synthetic peptide directed towards the N terminal of human ATP2A1. Synthetic peptide located within the following region: MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLW |
USD 370.00
2 Weeks
Glutamate receptor ionotropic, NMDA 2D (GRIN2D) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
Mouse Anti-CDK5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti-BAD (Phospho-Ser112) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanBAD around the phosphorylation site of serine 112 (H-S-SP-Y-P). |
| Modifications | Phospho-specific |
Rabbit anti-NOS2A polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human NOS2A. |
Rabbit polyclonal Caspase 9 (Tyr153) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of tyrosine 153 (L-A-YP-I-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal CASP8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CASP8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 432-461 amino acids from the C-terminal region of human CASP8. |
Rabbit polyclonal APOE antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human APOE. |
Rabbit Polyclonal IRE1 alpha [p Ser724] Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Rabbit (Does not react with: Primate) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding the phosphorylated serine 724 of the human IRE1 alpha protein. [Swiss-Prot #O75460] |
Rabbit Polyclonal Anti-ATP5F1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATP5F1 antibody: synthetic peptide directed towards the middle region of human ATP5F1. Synthetic peptide located within the following region: VTYRERLYRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSIST |
Rabbit Polyclonal Anti-NDUFV1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NDUFV1 antibody: synthetic peptide directed towards the N terminal of human NDUFV1. Synthetic peptide located within the following region: FMNKPSDGRPKYLVVNADEGEPGTCKDREILRHDPHKLLEGCLVGGRAMG |
Rabbit polyclonal anti-COX IV antibody, Loading control
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Bovine, Primate, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an internal region of the human COX4-1 protein (within residues 1-100). [Swiss-Prot# P13073] |
Rabbit Polyclonal antibody to Tau (microtubule-associated protein tau)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 171 and 266 of Tau (Uniprot ID#P10636) |
Rabbit polyclonal CDK5 (Tyr15) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDK5 around the phosphorylation site of tyrosine 15 (G-T-YP-G-T). |
| Modifications | Phospho-specific |
Rabbit polyclonal iNOS (Ab-151) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human iNOS around the phosphorylation site of tyrosine 151 (Q-Y-YP-G-S). |
Rabbit anti-CDK5 Polyclonal Antibody
| Applications | ICC/IF, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CDK5 |
Rabbit Polyclonal Anti-CHP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHP antibody: synthetic peptide directed towards the N terminal of human CHP. Synthetic peptide located within the following region: FTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFM |
Rabbit Polyclonal Anti-MAPT Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MAPT |
Active filters
Category
-
- Antibodies
-
Pathways
- Alzheimer's disease
Filter by
Target Symbol
- APP (111)
- MAPT (94)
- MAPK1 (74)
- LPL (61)
- BID (60)
- TNF (60)
- GAPDH (59)
- APOE (58)
- ATP5F1B (53)
- NDUFA7 (51)
- CASP3 (49)
- MME (45)
- NDUFB10 (39)
- COX6A1 (36)
- NAE1 (35)
- SNCA (35)
- NDUFB9 (34)
- SDHB (33)
- HSD17B10 (29)
- CHP1 (28)
- NOS2 (27)
- CASP9 (26)
- NOS3 (25)
- APBB1 (23)
- IL1B (23)
- MAPK3 (23)
- UQCRC1 (22)
- BAD (21)
- NDUFA4L2 (21)
- GSK3B (20)
- CASP8 (19)
- FAS (19)
- GRIN1 (19)
- CDK5 (18)
- GRIN2B (18)
- CASP7 (17)
- CYCS (17)
- NDUFB3 (15)
- NDUFS2 (14)
- PPP3CA (14)
- TNFRSF1A (13)
- APAF1 (12)
- CAPN2 (12)
- COX6C (12)
- COX4I1 (11)
- FADD (11)
- IDE (11)
- ATF6 (10)
- NOS1 (9)
- PPP3CB (9)
- ADAM17 (8)
- ATP2A2 (8)
- GRIN2A (8)
- UQCRFS1 (8)
- ATP5F1C (7)
- ERN1 (7)
- NDUFA5 (7)
- PSEN1 (7)
- ATP5PO (6)
- BACE1 (6)
- BACE2 (6)
- CACNA1C (6)
- CAPN1 (6)
- COX6B2 (6)
- EIF2AK3 (6)
- NDUFA2 (6)
- NDUFS1 (6)
- NDUFV2 (6)
- ADAM10 (5)
- COX6B1 (5)
- NDUFA8 (5)
- NDUFA9 (5)
- NDUFS8 (5)
- PSENEN (5)
- ATP2A1 (4)
- ATP5F1A (4)
- ATP5F1D (4)
- ATP5PF (4)
- CALM2 (4)
- COX5B (4)
- GRIN2C (4)
- LRP1 (4)
- NCSTN (4)
- NDUFA10 (4)
- NDUFA4 (4)
- NDUFS3 (4)
- NDUFS4 (4)
- PLCB3 (4)
- SDHA (4)
- APH1A (3)
- ATP2A3 (3)
- ATP5PB (3)
- ATP5PD (3)
- CALM3 (3)
- COX4I2 (3)
- COX5A (3)
- COX6A2 (3)
- COX7A1 (3)
- COX7A2 (3)
- COX7B (3)
Reactivities
- Human (1666)
- Mouse (1120)
- Rat (1066)
- Monkey (147)
- Dog (136)
- Bovine (27)
- Rabbit (19)
- Pig (17)
- Cow (15)
- Chicken (13)
- Canine (11)
- Chimpanzee (11)
- Xenopus (8)
- Primate (7)
- Rhesus Monkey (6)
- Drosophila (5)
- Feline (4)
- Gerbil (4)
- Porcine (4)
- Zebrafish (4)
- Hamster (3)
- X. tropicalis (3)
- Yeast (3)
- Avian (2)
- Bacteria (2)
- Canis (2)
- Goat (2)
- Insect (2)
- All Species (1)
- Equine (1)
- Eukaryote (1)
- Invertebrate (1)
- Macaque (1)
- Mammalian (1)
- Protozoa (1)
- Sheep (1)
Applications
Antibody Hosts
Isotypes
Clonalities
Conjugates
Carrier-free
Knockout (KO) Validation
Modifications
Assay Types
Assay Platforms
Families
- Druggable Genome (1331)
- Transmembrane (504)
- Protease (246)
- Secreted Protein (179)
- ES Cell Differentiation/IPS (153)
- Protein Kinase (148)
- Transcription Factors (115)
- Stem cell - Pluripotency (86)
- Adult stem cells (58)
- Ion Channels: Glutamate Receptors (52)
- Phosphatase (28)
- Ion Channels: Calcium (9)
- Ion Channels: Sodium (8)