Products

Download

Rabbit polyclonal anti-CIITA antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen used for this study was a bacterially produced recombinant FLAG-CIITA corresponding to amino acids 1 through 333 of the human protein.

Rabbit polyclonal anti-RFX5 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen RFX5 peptide corresponding to a region at amino acids 320 to 494 of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH).

Mouse Anti-Human CD40 Purified (100 ug)

Reactivities Human
Conjugation Unconjugated

Rat Anti-Human/Mouse CD45R (B220) Purified (100 ug)

Applications FC
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit polyclonal LCK Antibody (N-term)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This LCK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 23-52 amino acids from the N-terminal region of human LCK.

Rabbit Polyclonal CD19 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CD19

Rabbit Polyclonal CD19 (Tyr531) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human CD19 around the phosphorylation site of Tyrosine 531
Modifications Phospho-specific

Rabbit anti-IL2RG Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human IL2RG

Rabbit anti-RAG2 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human RAG2

Rabbit Polyclonal Anti-CD40LG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN

Rabbit Polyclonal Anti-IGLL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IGLL1 antibody: synthetic peptide directed towards the N terminal of human IGLL1. Synthetic peptide located within the following region: RSRWGRFLLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKAT

Rabbit Polyclonal Anti-CD40 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD

Rabbit Polyclonal Anti-CD40 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV

Rabbit Polyclonal Anti-CD8B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD8B antibody: synthetic peptide directed towards the N terminal of human CD8B. Synthetic peptide located within the following region: RIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFI

Rabbit Polyclonal Anti-CD8B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD8B antibody: synthetic peptide directed towards the middle region of human CD8B. Synthetic peptide located within the following region: KPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCR

Rabbit Polyclonal Anti-AIRE Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-AIRE Antibody: A synthesized peptide derived from human AIRE

Rabbit Polyclonal Anti-CD8A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD8A Antibody: A synthesized peptide derived from human CD8A

Rabbit Polyclonal Anti-CD8B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD8B Antibody: A synthesized peptide derived from human CD8B

Goat Polyclonal Anti-CD4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CD4 Antibody: Peptide with sequence C-KNKEVSVKRVTQDPK, from the internal region of the protein sequence according to NP_000607.1; NP_001181943.1.

Mouse Monoclonal Anti-CD4 Antibody [9H5A8]

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Mouse Monoclonal Anti-CD4 Antibody [8G1B12]

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal CD4 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

USD 300.00

In Stock

Goat Polyclonal Anti-CD19 Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide within residues 510 aa to the C-terminus of human CD19 produced in E. coli.

USD 450.00

In Stock

Goat Polyclonal Anti-CD45 Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli.

CD45 (PTPRC) mouse monoclonal antibody, clone BRA-55, Ascites

Applications IF, IHC, WB
Reactivities Human

CD3E mouse monoclonal antibody, clone OKT3, Aff - Purified

Applications FC, FN, IHC
Reactivities Human

CD45 (PTPRC) (CD45RA) mouse monoclonal antibody, clone n.a, FITC, Purified

Applications FC, IHC, IP
Reactivities Human
Conjugation FITC

CD45 (PTPRC) mouse monoclonal antibody, clone PD7/26/16 + 2B11, Purified

Applications FC, IF, IHC
Reactivities Human

CD3E mouse monoclonal antibody, clone B-B11, Azide Free

Applications FC, FN
Reactivities Human

CD4 mouse monoclonal antibody, clone B-A1, Purified

Applications FC, IHC
Reactivities Human

CD45 (PTPRC) mouse monoclonal antibody, clone ML2, Aff - Purified

Applications FC, IHC
Reactivities Human

CD45 (PTPRC) (CD45RA) mouse monoclonal antibody, clone MB1, Aff - Purified

Applications FC, IF, IHC
Reactivities Human

CD45 (PTPRC) (CD45RB) mouse monoclonal antibody, clone MT4, Aff - Purified

Applications FC, IF, IHC
Reactivities Human

IKK gamma (IKBKG) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

IKK gamma (IKBKG) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human

CD3E rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 31-80 of Human CD3-ε.

CD3D rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Synthetic peptide, corresponding to amino acids 21-70 of Human CD3-δ

ZAP70 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat

ZAP70 pTyr319 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic phosphopeptide derived from Human ZAP70 around the phosphorylation site of Tyrosine 319.

ZAP70 pTyr493 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat

CIITA (N-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide - KLH conjugated

CD8A mouse monoclonal antibody, clone LT8, Azide Free

Applications FC, IHC, IP
Reactivities Human

CD8A mouse monoclonal antibody, clone LT8, Purified

Applications FC, IHC, IP
Reactivities Human

CD8A mouse monoclonal antibody, clone LT8, Purified

Applications FC, IHC, IP
Reactivities Human

CD8A mouse monoclonal antibody, clone LT8, Purified

Applications FC, IHC, IP
Reactivities Human, Monkey

CD3E mouse monoclonal antibody, clone MEM-57, Low Endotoxin

Applications FC, FN, IP
Reactivities Human

Rabbit Polyclonal Antibody against CD19 (C-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CD19 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 393-421 amino acids from the C-terminal region of human CD19.

Rabbit Polyclonal Antibody against CD8A (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 150-180 amino acids from the C-terminal region of human CD8A.

Goat Polyclonal Antibody against AIRE (Internal Region)

Applications IHC, WB
Reactivities Human, Pig
Conjugation Unconjugated
Immunogen Peptide with sequence C-KDVDLSQPRKGRKP, from the internal region of the protein sequence according to NP_000374.1.

Rabbit Polyclonal TACI Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TACI antibody was raised against a synthetic peptide mapping at the amino terminus of human TACI .