Products

View as table Download

SNAP25 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SNAP25

Rabbit Polyclonal VAMP7 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen VAMP7 antibody was raised against an 18 amino acid synthetic peptide near the amino terminus of human VAMP7.

Rabbit Polyclonal Anti-CAT Antibody - middle region

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CAT antibody: synthetic peptide directed towards the middle region of human CAT. Synthetic peptide located within the following region: LKDAQIFIQKKAVKNFTEVHPDYGSHIQALLDKYNAEKPKNAIHTFVQSG

Rabbit Polyclonal Anti-MDS032 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MDS032 antibody: synthetic peptide directed towards the N terminal of human MDS032. Synthetic peptide located within the following region: ELNLVRLLSRCEAMAAEKRDPDEWRLEKYVGALEDMLQALKVHASKPASE

SNAP25 (Total) mouse monoclonal antibody, clone B372M, Supernatant

Applications ELISA, IHC

TSNARE1 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 363-391 amino acids from the C-terminal region of human TSNARE1

Rabbit polyclonal Syntaxin 1A (Ser14) antibody(Phospho-specific)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Syntaxin 1A around the phosphorylation site of serine 14 (K-D-SP-D-D)
Modifications Phospho-specific

Rabbit polyclonal SNAP25 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human SNAP25.

Rabbit Polyclonal Anti-C1orf142 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C1orf142 antibody: synthetic peptide directed towards the middle region of human C1orf142. Synthetic peptide located within the following region: TALHLQTSLPALSEADTQELTQILRRMKGLALEAESELERQDEALDGVAA

Rabbit Polyclonal Anti-USE1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-USE1 antibody: synthetic peptide directed towards the middle region of human USE1. Synthetic peptide located within the following region: DQNLEKLKTESERLEQHTQKSVNWLLWAMLIIVCFIFISMILFIRIMPKL

Rabbit Polyclonal Anti-SNAP23 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SNAP23 antibody: synthetic peptide directed towards the N terminal of human SNAP23. Synthetic peptide located within the following region: GIKTITMLDEQKEQLNRIEEGLDQINKDMRETEKTLTELNKCCGLCVCPC

Rabbit Polyclonal Anti-SNAP25 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SNAP25 Antibody: A synthesized peptide derived from human SNAP25

Rabbit Polyclonal Anti-VTI1a Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen VTI1a antibody was raised against a 19 amino acid peptide near the center of human VTI1a.

USD 300.00

In Stock

Goat Polyclonal Anti-STX6 Antibody

Applications WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 100 aa to the N-terminus of human STX6 produced in E. coli.

SNAP23 goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen Peptide with sequence from the internal region of the protein sequence according to NP_003816.2 and NP_570710.1.

Syntaxin 2 (STX2) (1-19) rabbit polyclonal antibody, Aff - Purified

Applications IHC, IP, WB
Reactivities Bovine, Chicken, Drosophila, Hamster, Human, Insect, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep, Xenopus
Immunogen STX2 antibody was raised against rat syntaxin 2 synthetic peptide, corresponding to amino acid residues 1-19, conjugated to KLH.

Syntaxin 1a (STX1A) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 36~65 amino acids from the N-terminal region of Human STX1A

Goat Polyclonal Antibody against SNAP25

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-DEANQRATKMLGSG, from the C Terminus of the protein sequence according to NP_003072.2; NP_570824.1.

Rabbit Polyclonal antibody to Syntaxin 5 (syntaxin 5)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 51 and 307 of Syntaxin 5 (Uniprot ID#Q13190)

Rabbit polyclonal anti-VTI1B antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human VTI1B.

Rabbit polyclonal anti-VTI1A antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human VTI1A.

Rabbit Polyclonal Syntaxin 1A Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Syntaxin 1A

Rabbit Polyclonal Syntaxin 1A (Ser14) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Syntaxin 1A around the phosphorylation site of Serine 14
Modifications Phospho-specific

Rabbit Polyclonal STX11 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Syntaxin 12 (STX12) (Cytopl. Dom.) mouse monoclonal antibody, clone 15G2, Purified

Applications IHC, WB
Reactivities Canine, Hamster, Human, Mouse, Rat

SNAP23 (1-132) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 1 and 132 of Human SNAP23

STX19 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 257-288 amino acids from the C-terminal region of Human STX19.

Syntaxin 2 (STX2) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 122-152 amino acids from the Central region of Human STX2

Rabbit polyclonal antibody to Syntaxin 4 (syntaxin 4)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 92 and 297 of Syntaxin 4 (Uniprot ID#Q12846)

Mouse monoclonal VAMP1/2 Antibody

Applications IHC, WB
Reactivities Human. Not yet tested in other species

Mouse monoclonal SNAP-25 Antibody

Applications WB
Reactivities Feline, Human, Mouse, Rat, Pig

Rabbit polyclonal anti-VAMP8 antibody (N-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This VAMP8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human VAMP8.

Rabbit Polyclonal Anti-USE1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-USE1 antibody: synthetic peptide directed towards the middle region of human USE1. Synthetic peptide located within the following region: ARSLKTNTLAAQSVIKKDNQTLSHSLKMADQNLEKLKTESERLEQHTQKS

VTI1A (C-term) rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide selected from the C-terminal region of human VTI1A

SNAP25 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence at the C-terminal of human SNAP25

STX10 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 60-89 amino acids from the N-terminal region of Human STX10

Syntaxin 12 (STX12) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 223-251 amino acids from the C-terminal region of Human STX12

Syntaxin 16 (STX16) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 254-282 amino acids from the C-terminal region of Human STX16.

Syntaxin 5A (STX5) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 179-209 amino acids from the Central region of human STX5

Syntaxin 6 (STX6) (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 120-149 amino acids from the Central region of human STX6

Syntaxin 8 (STX8) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 15-44 amino acids from the N-terminal region of human STX8

VAMP3 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 14-43 amino acids from the Central region of human VAMP3

Goat Polyclonal Antibody against BNIP1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DLLRQRKTTKESLAQ, from the internal region of the protein sequence according to NP_001196.1; NP_053581.1; NP_053582.1; NP_053583.1.

Goat Polyclonal Antibody against STX6

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QALAERKNRQA, from the internal region of the protein sequence according to NP_005810.1.

Goat Polyclonal Antibody against VTI1B

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RDFDEKQQEANET, from the internal region of the protein sequence according to NP_006361.1.

Mouse Anti-Synaptobrevin (VAMP) Antibody

Applications WB
Reactivities Bovine, Hamster, Human, Mouse, Porcine, Rabbit, Rat
Conjugation Unconjugated

Mouse Anti-Syntaxin Antibody

Applications WB
Reactivities Hamster, Human, Porcine, Rat
Conjugation Unconjugated