Germany
Japan
United Kingdom
China
Cytokeratin 5 (KRT5) guinea pig polyclonal antibody, Serum
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse |
| Immunogen | Recombinant Human keratin K5. |
Products
Collagen I (COL1A1) rabbit polyclonal antibody, Biotin
| Applications | ELISA, FC, IHC, IP, WB |
| Reactivities | Bovine, Human, Mammalian, Mouse, Rat |
| Conjugation | Biotin |
| Immunogen | Collagen Type I from Human and Bovine placenta. |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
PGK1 rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bakers Yeast |
| Immunogen | 3-Phosphoglyceric Phosphokinase isolated and purified from baker's yeast. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Epstein Barr Virus / EBV EBNA 3A sheep polyclonal antibody, Purified
| Applications | WB |
| Immunogen | Recombinant EBNA-3A protein. |
LYVE1 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, FC, IF, IHC, WB |
| Reactivities | Human |
| Immunogen | Highly pure recombinant Human soluble LYVE-1 produced in insect cells (Cat.-No DA3525). It consists of amino acid 24 (Ser) to 232 (Gly) and is fused to a C-terminal His-tag (6xHis). |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
DiMethyl-Histone H3-K4 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3 |
Goat Anti-Neurofascin / NFASC (aa877-890) Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NFSPNQTKFTVQRT, from the internal region of the protein sequence according to NP_001005388.2; NP_001153803.1; NP_001153804.1; NP_055905.2;. |
EDG1 (S1PR1) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide derived from the C-terminal of the EDG-1 receptor |
Perilipin-1 (PLIN1) guinea pig polyclonal antibody, Serum
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | Duplicated N-terminus of Perilipin, aa 1-20 (cf. Greenberg et al. 1992, JBC 266, 11341-11346) |
Cytokeratin 20 (KRT20) guinea pig polyclonal antibody, Serum
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide of Human keratin K20 (formerly also designated cytokeratin 20) |
Serotonin rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Mammalian, Snail |
Fibrinogen rabbit polyclonal antibody, Purified
| Applications | ELISA, WB |
| Reactivities | Mouse |
| Immunogen | Native Mouse Fibrinogen. |
Lipopolysaccharide (LPS gram negative bacteria) goat polyclonal antibody, Purified
| Applications | IF |
| Reactivities | Enterobacter |
| Immunogen | Whole cells prep of Lipid A from E. coli O157 |
Gastrin (GAST) guinea pig polyclonal antibody, Serum
| Applications | IF, IHC |
| Reactivities | Human, Rat |
| Immunogen | Synthetic Human Gastrin I conjugated to BSA |
Borrelia burgdorferi rabbit polyclonal antibody, Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Bacteria |
| Immunogen | Whole cell preparation from B. burgdorferi (Strain: B31 ATCC#35210) |
Rabbit polyclonal SLC11A2 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SLC11A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 262-291 amino acids from the Central region of human SLC11A2. |
DiMethyl-Histone H3-K36 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K36 of human histone H3 |
GFP (Ads. to Hu, Ms, Rt Serum Proteins) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | A. victoria |
| Immunogen | Green Fluorescent Protein (GFP) fusion protein corresponding to the full length amino acid sequence (246aa) derived from the jellyfish Aequorea victoria |
Symmetric DiMethyl-Histone H3-R8 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding R8 of human histone H3 |
S1PR2 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to amino acids 271-320 of Human EDG-5. |
Nidogen-2 rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, R, WB |
| Reactivities | Mouse |
| Immunogen | Recombinant Mouse Nidogen 2 |
GFAP guinea pig polyclonal antibody, Serum
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Rat |
| Immunogen | Gliafilament protein purified from Bovine spinal cord. |
Sodium Iodide Symporter (SLC5A5) (C-term) rabbit polyclonal antibody, Serum
| Applications | IF, IHC |
| Reactivities | Human, Porcine, Rat |
| Immunogen | Synthetic peptide from the C-terminus of Rat NIS |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Nidogen-2 rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, R, WB |
| Reactivities | Mouse |
| Immunogen | Recombinant Mouse Nidogen 2 |
Rabbit Polyclonal OCLN Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | OCLN antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human OCLN. The immunogen is located within the last 50 amino acids of OCLN. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Clonalities
- Polyclonal
Filter by
Target Symbol
- EGFR (105)
- AKT1 (75)
- TP53 (74)
- H3C1 (63)
- RELA (62)
- MAPT (57)
- RPS6KB1 (47)
- IRS1 (45)
- MAP2K1 (45)
- CTNNB1 (44)
- KDR (43)
- ERBB2 (41)
- JUN (41)
- POMC (41)
- APP (39)
- ALB (38)
- STAT3 (38)
- FOXO1 (37)
- MAPK14 (37)
- C3 (36)
- EIF4EBP1 (36)
- PRKAA1 (36)
- PTK2 (36)
- RAF1 (36)
- CREB1 (35)
- STAT1 (35)
- BRCA1 (34)
- ESR1 (34)
- SMAD2 (34)
- CASP3 (33)
- CHUK (33)
- HIF1A (33)
- HSPB1 (33)
- GAPDH (32)
- GCG (32)
- BCL2 (31)
- COL1A1 (31)
- GSK3B (31)
- HIST1H3A (31)
- NFKBIA (31)
- PAK1 (31)
- RB1 (31)
- SMAD3 (31)
- IL6 (30)
- MAPK8 (30)
- MYC (30)
- NOS3 (30)
- NPPA (30)
- SNCA (30)
- TNF (30)
- CASP9 (29)
- CHEK1 (29)
- EDN1 (29)
- EZR (29)
- GRIN1 (29)
- MAP3K5 (29)
- MET (29)
- NFKB1 (29)
- SMAD1 (29)
- SRC (29)
- CDC25A (28)
- IGF1R (28)
- IL1B (28)
- JAK2 (28)
- PRKCD (28)
- VIM (28)
- YAP1 (28)
- ATF2 (27)
- CDK1 (27)
- CHEK2 (27)
- GFAP (27)
- NR3C1 (27)
- PDGFRB (27)
- PRKCA (27)
- TH (27)
- BRAF (26)
- CALCA (26)
- CCNB1 (26)
- CDH1 (26)
- FGFR1 (26)
- GRIN2B (26)
- PIK3R1 (26)
- STMN1 (26)
- ABL1 (25)
- BAD (25)
- BAX (25)
- CDKN2A (25)
- CSF1R (25)
- CXCL12 (25)
- GJA1 (25)
- IGF1 (25)
- MAPK1 (25)
- S PROTEIN (25)
- VEGFA (25)
- EGF (24)
- H3-4 (24)
- HISTONE H3 (24)
- IKBKG (24)
- IL4 (24)
- MTOR (24)
Reactivities
- Human (62322)
- Mouse (34441)
- Rat (24726)
- Dog (1293)
- Bovine (1022)
- Cow (835)
- Pig (821)
- Monkey (639)
- Chicken (355)
- Rabbit (290)
- Xenopus (225)
- Hamster (206)
- Canine (194)
- Gorilla (179)
- Rhesus Monkey (168)
- Zebrafish (165)
- Primate (164)
- Horse (160)
- Mammalian (148)
- Porcine (145)
- Gibbon (141)
- Chimpanzee (137)
- Bat (118)
- X. tropicalis (101)
- Murine (91)
- Guinea Pig (61)
- Sheep (58)
- Feline (50)
- Orang-Utan (46)
- Drosophila (45)
- Other (Wide Range) (34)
- SARS-CoV-2 (31)
- Broad (26)
- C. elegans (19)
- Macaque (19)
- Equine (18)
- Canis (12)
- Fish (11)
- Goat (11)
- Avian (8)
- Yeast (8)
- Gerbil (7)
- Opossum (6)
- SARS-CoV (5)
- Quail (4)
- Saccharomyces cerevisiae (4)
- Arabidopsis (3)
- EV-71 (3)
- Escherichia coli (3)
- Frog (3)
- Fusion proteins containing the Flag Tag (3)
- HCoV-HKU1 (3)
- HCoV-OC43 (3)
- Invertebrate (3)
- Turkey (3)
- Baboon (2)
- Coral (2)
- Fungus (2)
- HCoV-229E (2)
- Pufferfish (2)
- Streptococcus Pyogenes (2)
- 5-FAM (1)
- Algal (1)
- Amphibian (1)
- Beluga (1)
- Biotin (1)
- Birds (1)
- Carp (1)
- Digoxin (1)
- Dogfish (1)
- Eukaryote (1)
- FITC (1)
- Ferret (1)
- HCoV-NL63 (1)
- Hagfish (1)
- Horseradish Peroxidase (1)
- Insect (1)
- Medaka fish (1)
- Mink (1)
- Mustelid (1)
- Protozoa (1)
- SimianIVE (1)
- Staphylococcus aureus (1)
- Tadpole (1)
- Tobacco (1)
- Tobacco hornworm (1)
- Tomato (1)
- Tree Shrew (1)
- Whale (1)
Applications
- WB (72498)
- IHC (34191)
- IF (10794)
- ELISA (8957)
- IP (2307)
- FC (1668)
- R (720)
- ID (677)
- ICC/IF (622)
- FN (325)
- Dot (131)
- ChIP (110)
- Assay (88)
- CT (27)
- AP (24)
- EMSA (23)
- NEUT (19)
- EM (14)
- Ie (13)
- 10k-ChIP (11)
- ICC (7)
- AGG (3)
- IHC-F (2)
- IHC-P (2)
- C (1)
- E(capture) (1)
- LF (1)
- MA (1)
- Neutralize (1)
- P (1)
- RID (1)
- TOBI (1)
Antibody Hosts
Isotypes
Conjugates
Knockout (KO) Validation
Modifications
- Unmodified (9273)
- Phospho-specific (1465)
- Phospho S83 (6)
- Acetyl K5 (4)
- Phospho S15 (3)
- Phospho S166 (3)
- Phospho S376 (3)
- Phospho T286 (3)
- Acetyl K12 (2)
- Acetyl K16 (2)
- Acetyl K27 (2)
- Acetyl K36 (2)
- Acetyl K4 (2)
- MonoMethyl K342 (2)
- Phospho S104 (2)
- Phospho S127 (2)
- Phospho S128 (2)
- Phospho S129 (2)
- Phospho S139 (2)
- Phospho S16 (2)
- Phospho S176/180 (2)
- Phospho S21 (2)
- Phospho S319 (2)
- Phospho S345 (2)
- Phospho S366 (2)
- Phospho S37 (2)
- Phospho S380 (2)
- Phospho S39 (2)
- Phospho S396 (2)
- Phospho S56 (2)
- Phospho S616 (2)
- Phospho S727 (2)
- Phospho S795 (2)
- Phospho S89 (2)
- Phospho S9 (2)
- Phospho T183/T172 (2)
- Phospho T187 (2)
- Phospho T389 (2)
- Phospho T514 (2)
- Phospho Y410 (2)
- Phospho Y779 (2)
- Phospho Y925 (2)
- TriMethyl K56 (2)
- Acetyl K14 (1)
- Acetyl K15 (1)
- Acetyl K18 (1)
- Acetyl K23 (1)
- Acetyl K262/K265/K274 (1)
- Acetyl K29 (1)
- Acetyl K332 (1)
- Acetyl K56 (1)
- Acetyl K8 (1)
- Acetyl K9 (1)
- Acetyl K9/K14/K18/K23/K27 (1)
- Acetyl K91 (1)
- Asymmetric DiMethyl R3 (1)
- DiMethyl K385 (1)
- K11-linkage Specific Polyubiquitin (1)
- K27-linkage Specific Polyubiquitin (1)
- K29-linkage Specific Polyubiquitin (1)
- K33-linkage Specific Polyubiquitin (1)
- K48-linkage Specific Polyubiquitin (1)
- K6-linkage Specific Polyubiquitin (1)
- K63-linkage Specific Polyubiquitin (1)
- M1-linkage Specific Polyubiquitin (1)
- MonoMethyl K36 (1)
- MonoMethyl K5 (1)
- Pan Acetyl-Lysine (1)
- Pan DiMethyl-lysine (1)
- Pan Phospho-Tyrosine (1)
- Phospho 180/Y182,Phospho T180/Y182,Phospho T180/Y182,Phospho T183/Y1845 (1)
- Phospho Phospho S87 (1)
- Phospho S1 (1)
- Phospho S10 (1)
- Phospho S10/T11 (1)
- Phospho S102 (1)
- Phospho S1033 (1)
- Phospho S11 (1)
- Phospho S1105 (1)
- Phospho S1108 (1)
- Phospho S112 (1)
- Phospho S1177 (1)
- Phospho S1248 (1)
- Phospho S1387 (1)
- Phospho S1490 (1)
- Phospho S157 (1)
- Phospho S16/T17 (1)
- Phospho S17 (1)
- Phospho S172 (1)
- Phospho S176 (1)
- Phospho S180 (1)
- Phospho S182 (1)
- Phospho S189,Phospho S207 (1)
- Phospho S19 (1)
- Phospho S194 (1)
- Phospho S1943 (1)
- Phospho S1981 (1)
- Phospho S199/S204 (1)
- Phospho S2 (1)
- Phospho S20 (1)
- Phospho S202 (1)
- Phospho S2056 (1)
- Phospho S209 (1)
- Phospho S211 (1)
- Phospho S2152 (1)
- Phospho S217 (1)
- Phospho S22 (1)
- Phospho S235/236 (1)
- Phospho S240/244 (1)
- Phospho S241 (1)
- Phospho S243 (1)
- Phospho S2448 (1)
- Phospho S2481 (1)
- Phospho S253 (1)
- Phospho S257 (1)
- Phospho S257/T261 (1)
- Phospho S259 (1)
- Phospho S271 (1)
- Phospho S271/T275 (1)
- Phospho S28 (1)
- Phospho S280 (1)
- Phospho S29/33/37/T41 (1)
- Phospho S291 (1)
- Phospho S293 (1)
- Phospho S294 (1)
- Phospho S296 (1)
- Phospho S298 (1)
- Phospho S299 (1)
- Phospho S304 (1)
- Phospho S307 (1)
- Phospho S308,Phospho S309,Phospho S305 (1)
- Phospho S32 (1)
- Phospho S32/S36 (1)
- Phospho S320 (1)
- Phospho S323 (1)
- Phospho S326 (1)
- Phospho S33 (1)
- Phospho S33/35 (1)
- Phospho S33/S37/T41 (1)
- Phospho S330 (1)
- Phospho S334 (1)
- Phospho S338 (1)
- Phospho S358 (1)
- Phospho S36 (1)
- Phospho S365 (1)
- Phospho S380/T382/383 (1)
- Phospho S386 (1)
- Phospho S392 (1)
- Phospho S397 (1)
- Phospho S4/S8 (1)
- Phospho S40 (1)
- Phospho S409/S410 (1)
- Phospho S412 (1)
- Phospho S420 (1)
- Phospho S422 (1)
- Phospho S423/S425 (1)
- Phospho S425 (1)
- Phospho S428 (1)
- Phospho S445 (1)
- Phospho S448 (1)
- Phospho S45 (1)
- Phospho S455 (1)
- Phospho S46 (1)
- Phospho S465/467 + S423/425 (1)
- Phospho S465/S467 (1)
- Phospho S467 (1)
- Phospho S471/472 (1)
- Phospho S473 (1)
- Phospho S473,Phospho S474,Phospho S472 (1)
- Phospho S474 (1)
- Phospho S483 (1)
- Phospho S485 (1)
- Phospho S5 (1)
- Phospho S505 (1)
- Phospho S507 (1)
- Phospho S51 (1)
- Phospho S516 (1)
- Phospho S519/T522 (1)
- Phospho S529 (1)
- Phospho S552 (1)
- Phospho S555 (1)
- Phospho S563 (1)
- Phospho S588 (1)
- Phospho S6 (1)
- Phospho S608 (1)
- Phospho S611/615 (1)
- Phospho S611/615/616 (1)
- Phospho S612 (1)
- Phospho S615 (1)
- Phospho S62 (1)
- Phospho S621 (1)
- Phospho S63 (1)
- Phospho S636/639 (1)
- Phospho S637 (1)
- Phospho S638 (1)
- Phospho S641 (1)
- Phospho S643/676 (1)
- Phospho S645 (1)
- Phospho S65 (1)
- Phospho S657/Y658 (1)
- Phospho S660 (1)
- Phospho S668 (1)
- Phospho S675 (1)
- Phospho S7 (1)
- Phospho S70 (1)
- Phospho S71 (1)
- Phospho S728 (1)
- Phospho S73 (1)
- Phospho S744/748 (1)
- Phospho S757 (1)
- Phospho S80 (1)
- Phospho S807/811 (1)
- Phospho S811 (1)
- Phospho S82 (1)
- Phospho S838/S840 (1)
- Phospho S845 (1)
- Phospho S886 (1)
- Phospho S890 (1)
- Phospho S896/S897 (1)
- Phospho S897 (1)
- Phospho S916 (1)
- Phospho S932 (1)
- Phospho S957 (1)
- Phospho S967 (1)
- Phospho Ser15 (1)
- Phospho Ser198/Ser199/Ser202 (1)
- Phospho Ser355 (1)
- Phospho Ser404 (1)
- Phospho Ser416 (1)
- Phospho Ser551 (1)
- Phospho Ser729 (1)
- Phospho Ser792 (1)
- Phospho Ser90 (1)
- Phospho T11 (1)
- Phospho T117 (1)
- Phospho T14 (1)
- Phospho T1462 (1)
- Phospho T156 (1)
- Phospho T163 (1)
- Phospho T17 (1)
- Phospho T172 (1)
- Phospho T179 (1)
- Phospho T18 (1)
- Phospho T18/S19 (1)
- Phospho T180/T183 (1)
- Phospho T180/Y182 (1)
- Phospho T180/Y182 + T183/Y1845 (1)
- Phospho T181 (1)
- Phospho T183/Y185 (1)
- Phospho T183/Y185,Phospho T221/Y223 (1)
- Phospho T184/T187 (1)
- Phospho T186 (1)
- Phospho T189 (1)
- Phospho T197 (1)
- Phospho T197/202 (1)
- Phospho T1989 (1)
- Phospho T199 (1)
- Phospho T202/Y204 + T185/Y187 (1)
- Phospho T202/Y204+T185/Y187 (1)
- Phospho T204 (1)
- Phospho T210 (1)
- Phospho T212 (1)
- Phospho T217 (1)
- Phospho T23 (1)
- Phospho T231 (1)
- Phospho T231/S232 (1)
- Phospho T232 (1)
- Phospho T235 (1)
- Phospho T24,Phospho T32,Phospho T28 (1)
- Phospho T246 (1)
- Phospho T261 (1)
- Phospho T288 (1)
- Phospho T288,Phospho T232,Phospho T198 (1)
- Phospho T292 (1)
- Phospho T3 (1)
- Phospho T308 (1)
- Phospho T32 (1)
- Phospho T320 (1)
- Phospho T334 (1)
- Phospho T346 (1)
- Phospho T357/S358/S360 (1)
- Phospho T359 (1)
- Phospho T359/S363 (1)
- Phospho T37/46 (1)
- Phospho T384 (1)
- Phospho T387 (1)
- Phospho T395 (1)
- Phospho T410 (1)
- Phospho T421/S424 (1)
- Phospho T434 (1)
- Phospho T446 (1)
- Phospho T45 (1)
- Phospho T495 (1)
- Phospho T498 (1)
- Phospho T505 (1)
- Phospho T508/T505 (1)
- Phospho T538 (1)
- Phospho T543 (1)
- Phospho T56 (1)
- Phospho T567,Phospho T564,Phospho T558 (1)
- Phospho T573 (1)
- Phospho T58 (1)
- Phospho T581 (1)
- Phospho T6 (1)
- Phospho T641 (1)
- Phospho T642 (1)
- Phospho T668 (1)
- Phospho T669 (1)
- Phospho T678 (1)
- Phospho T69/71 (1)
- Phospho T69/T71 (1)
- Phospho T696 (1)
- Phospho T70 (1)
- Phospho T81 (1)
- Phospho T845 (1)
- Phospho T853 (1)
- Phospho T91 (1)
- Phospho T918 (1)
- Phospho T93 (1)
- Phospho T982 (1)
- Phospho Thr212/Ser214 (1)
- Phospho Thr421 (1)
- Phospho Y10 (1)
- Phospho Y1007 (1)
- Phospho Y1007/1008 (1)
- Phospho Y1008 (1)
- Phospho Y1018 (1)
- Phospho Y1020 (1)
- Phospho Y1021 (1)
- Phospho Y1022/1023 (1)
- Phospho Y1045 (1)
- Phospho Y1054/1055 (1)
- Phospho Y1068 (1)
- Phospho Y1070 (1)
- Phospho Y1086 (1)
- Phospho Y1096 (1)
- Phospho Y1148 (1)
- Phospho Y1165/1166,Phospho Y1189/1190 (1)
- Phospho Y1173 (1)
- Phospho Y1175 (1)
- Phospho Y1189/Y1190,Phospho Y1165/Y1166 (1)
- Phospho Y1217 (1)
- Phospho Y1221/1222 (1)
- Phospho Y1234/1235 (1)
- Phospho Y1248 (1)
- Phospho Y1284 (1)
- Phospho Y133 (1)
- Phospho Y1349 (1)
- Phospho Y1361 (1)
- Phospho Y138 (1)
- Phospho Y139 (1)
- Phospho Y14 (1)
- Phospho Y145 (1)
- Phospho Y1474 (1)
- Phospho Y15 (1)
- Phospho Y165 (1)
- Phospho Y171 (1)
- Phospho Y177 (1)
- Phospho Y182 (1)
- Phospho Y191 (1)
- Phospho Y204 (1)
- Phospho Y207 (1)
- Phospho Y216 (1)
- Phospho Y221 (1)
- Phospho Y232 (1)
- Phospho Y245 (1)
- Phospho Y284 (1)
- Phospho Y291 (1)
- Phospho Y292 (1)
- Phospho Y307 (1)
- Phospho Y311 (1)
- Phospho Y317 (1)
- Phospho Y322 (1)
- Phospho Y323 (1)
- Phospho Y340 (1)
- Phospho Y353 (1)
- Phospho Y397 (1)
- Phospho Y402 (1)
- Phospho Y412 (1)
- Phospho Y416 (1)
- Phospho Y416/Y416 (1)
- Phospho Y467/Y199/Y464 (1)
- Phospho Y564 (1)
- Phospho Y576/577 (1)
- Phospho Y589/591 (1)
- Phospho Y594 (1)
- Phospho Y653 (1)
- Phospho Y659 (1)
- Phospho Y674/675 + Y706/707 (1)
- Phospho Y694 (1)
- Phospho Y699 (1)
- Phospho Y700 (1)
- Phospho Y705 (1)
- Phospho Y708 (1)
- Phospho Y719 (1)
- Phospho Y723 (1)
- Phospho Y724 (1)
- Phospho Y731 (1)
- Phospho Y751 (1)
- Phospho Y754 (1)
- Phospho Y759 (1)
- Phospho Y771 (1)
- Phospho Y789 (1)
- Phospho Y792 (1)
- Phospho Y845 (1)
- Phospho Y849 (1)
- Phospho Y869 (1)
- Phospho Y980/981 (1)
- Phospho Y992 (1)
- Phospho Y996 (1)
- Phospho Y998 (1)
- Phospho pS221 (1)
- Phospho s724 (1)
- Phospho-(Ser/Thr) (1)
- Phospho-PKC (pan) (βII Ser660) (1)
- Phospho-RPS6KB1-S371 (1)
- Ubiquityl K119 (1)
- Unconjugated (1)
- citrulline R2/R8/R17 (1)
- monoMethyl E105 (1)
- pan Phospho-Serine/Threonine (1)
- pan Symmetric-DiMethyl-Arginine (1)
- pan-Di-Methyl K (1)
- pan-Mono-Methyl K (1)
- pan-Mono-MethylR（R*GG） (1)
- pan-Myristyl-G (1)
- pan-Phospho-Serine (1)
- pan-TriMethyl-lysine (1)
- pan-tri-Methyl K (1)
- phospho S76 (1)
- phospho T1079,Phospho T1041 (1)
- succinylation K79 (1)
Assay Types
Families
- Druggable Genome (24729)
- Transmembrane (11472)
- Transcription Factors (6843)
- Secreted Protein (3934)
- Protein Kinase (2866)
- ES Cell Differentiation/IPS (2401)
- Stem cell - Pluripotency (1564)
- Protease (1428)
- GPCR (1425)
- Adult stem cells (553)
- Phosphatase (458)
- Embryonic stem cells (453)
- Nuclear Hormone Receptor (395)
- Cancer stem cells (383)
- Ion Channels: Other (341)
- Stem cell relevant signaling - JAK/STAT signaling pathway (322)
- Induced pluripotent stem cells (282)
- Ion Channels: Potassium (206)
- P450 (192)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (162)
- Stem cell relevant signaling - DSL/Notch pathway (146)
- Stem cell relevant signaling - Wnt Signaling pathway (142)
- Ion Channels: Cys-loop Receptors (138)
- Ion Channels: Transient receptor potential (115)
- Ion Channels: Glutamate Receptors (113)
- Ion Channels: Sodium (40)
- Ion Channels: ATP Receptors (27)
- Ion Channels: Cyclic nucleotide gated (18)
- Ion Channels: Calcium (15)
Pathways
- Metabolic pathways (3013)
- Pathways in cancer (2963)
- MAPK signaling pathway (1912)
- Focal adhesion (1564)
- Cytokine-cytokine receptor interaction (1543)
- Neuroactive ligand-receptor interaction (1336)
- Chemokine signaling pathway (1267)
- Prostate cancer (1218)
- Regulation of actin cytoskeleton (1204)
- Neurotrophin signaling pathway (1199)
- ErbB signaling pathway (997)
- Colorectal cancer (986)
- Pancreatic cancer (971)
- Insulin signaling pathway (959)
- Cell cycle (958)
- T cell receptor signaling pathway (955)
- Jak-STAT signaling pathway (952)
- Chronic myeloid leukemia (943)
- Calcium signaling pathway (924)
- Wnt signaling pathway (918)
- Endocytosis (904)
- Toll-like receptor signaling pathway (875)
- Apoptosis (863)
- Small cell lung cancer (855)
- Alzheimer's disease (818)
- Leukocyte transendothelial migration (807)
- Melanoma (787)
- Acute myeloid leukemia (763)
- Huntington's disease (752)
- Glioma (747)
- Natural killer cell mediated cytotoxicity (736)
- Progesterone-mediated oocyte maturation (725)
- Endometrial cancer (710)
- Non-small cell lung cancer (696)
- Fc gamma R-mediated phagocytosis (694)
- B cell receptor signaling pathway (692)
- Adipocytokine signaling pathway (690)
- Adherens junction (669)
- VEGF signaling pathway (663)
- Tight junction (653)
- Axon guidance (651)
- GnRH signaling pathway (641)
- Melanogenesis (636)
- Renal cell carcinoma (630)
- Oocyte meiosis (622)
- Gap junction (611)
- p53 signaling pathway (608)
- Epithelial cell signaling in Helicobacter pylori infection (607)
- Fc epsilon RI signaling pathway (590)
- Bladder cancer (567)
- TGF-beta signaling pathway (558)
- Olfactory transduction (551)
- NOD-like receptor signaling pathway (550)
- Amyotrophic lateral sclerosis (ALS) (547)
- Ubiquitin mediated proteolysis (543)
- Vascular smooth muscle contraction (526)
- mTOR signaling pathway (513)
- RIG-I-like receptor signaling pathway (496)
- Cell adhesion molecules (CAMs) (492)
- Hematopoietic cell lineage (478)
- Systemic lupus erythematosus (452)
- Parkinson's disease (450)
- Long-term potentiation (447)
- Long-term depression (437)
- Pathogenic Escherichia coli infection (414)
- Purine metabolism (402)
- Hypertrophic cardiomyopathy (HCM) (400)
- Dilated cardiomyopathy (394)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (384)
- Basal cell carcinoma (353)
- Complement and coagulation cascades (352)
- Cytosolic DNA-sensing pathway (349)
- Type II diabetes mellitus (339)
- ECM-receptor interaction (338)
- Thyroid cancer (329)
- Viral myocarditis (324)
- PPAR signaling pathway (322)
- Antigen processing and presentation (309)
- Spliceosome (309)
- Lysosome (300)
- Glycolysis / Gluconeogenesis (292)
- Prion diseases (267)
- Oxidative phosphorylation (258)
- Hedgehog signaling pathway (249)
- Notch signaling pathway (235)
- Drug metabolism - cytochrome P450 (228)
- Arginine and proline metabolism (225)
- Ribosome (225)
- Dorso-ventral axis formation (224)
- Pyrimidine metabolism (224)
- Vibrio cholerae infection (223)
- Metabolism of xenobiotics by cytochrome P450 (222)
- Phosphatidylinositol signaling system (215)
- Primary immunodeficiency (212)
- Cardiac muscle contraction (202)
- Type I diabetes mellitus (202)
- Arachidonic acid metabolism (189)
- Tyrosine metabolism (186)
- Nucleotide excision repair (181)
- Retinol metabolism (177)
- Valine (175)
- Pyruvate metabolism (168)
- Allograft rejection (167)
- Tryptophan metabolism (164)
- Graft-versus-host disease (161)
- Autoimmune thyroid disease (158)
- Base excision repair (156)
- Fatty acid metabolism (156)
- RNA degradation (156)
- Glycerophospholipid metabolism (151)
- leucine and isoleucine degradation (151)
- Glycerolipid metabolism (146)
- Regulation of autophagy (145)
- Proteasome (144)
- Glutathione metabolism (141)
- ABC transporters (139)
- Alanine (138)
- aspartate and glutamate metabolism (138)
- Inositol phosphate metabolism (137)
- Maturity onset diabetes of the young (135)
- Butanoate metabolism (134)
- Drug metabolism - other enzymes (133)
- Homologous recombination (133)
- Cysteine and methionine metabolism (129)
- DNA replication (129)
- Lysine degradation (129)
- Citrate cycle (TCA cycle) (125)
- Fructose and mannose metabolism (124)
- Sphingolipid metabolism (121)
- Amino sugar and nucleotide sugar metabolism (119)
- Starch and sucrose metabolism (114)
- Asthma (113)
- Taste transduction (113)
- Basal transcription factors (110)
- Androgen and estrogen metabolism (105)
- Propanoate metabolism (104)
- Porphyrin and chlorophyll metabolism (103)
- Histidine metabolism (102)
- Mismatch repair (102)
- Glycine (93)
- serine and threonine metabolism (93)
- SNARE interactions in vesicular transport (89)
- Phenylalanine metabolism (88)
- Non-homologous end-joining (87)
- Linoleic acid metabolism (84)
- Renin-angiotensin system (82)
- Pentose phosphate pathway (81)
- Nitrogen metabolism (80)
- beta-Alanine metabolism (80)
- Ether lipid metabolism (78)
- Galactose metabolism (76)
- N-Glycan biosynthesis (73)
- Nicotinate and nicotinamide metabolism (70)
- Aminoacyl-tRNA biosynthesis (68)
- Biosynthesis of unsaturated fatty acids (63)
- Primary bile acid biosynthesis (58)
- RNA polymerase (58)
- Selenoamino acid metabolism (54)
- O-Glycan biosynthesis (53)
- Riboflavin metabolism (53)
- Ascorbate and aldarate metabolism (52)
- Glycosaminoglycan degradation (52)
- Glyoxylate and dicarboxylate metabolism (50)
- Pentose and glucuronate interconversions (50)
- Circadian rhythm - mammal (48)
- Terpenoid backbone biosynthesis (48)
- Limonene and pinene degradation (44)
- Glycosphingolipid biosynthesis - lacto and neolacto series (41)
- One carbon pool by folate (41)
- C21-Steroid hormone metabolism (40)
- Taurine and hypotaurine metabolism (40)
- Folate biosynthesis (39)
- Heparan sulfate biosynthesis (39)
- Chondroitin sulfate biosynthesis (37)
- alpha-Linolenic acid metabolism (36)
- Other glycan degradation (33)
- Caffeine metabolism (32)
- Pantothenate and CoA biosynthesis (32)
- Synthesis and degradation of ketone bodies (32)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (31)
- leucine and isoleucine biosynthesis (31)
- Keratan sulfate biosynthesis (30)
- Methane metabolism (30)
- Steroid biosynthesis (27)
- Sulfur metabolism (25)
- Glycosphingolipid biosynthesis - ganglio series (24)
- Phenylalanine (24)
- tyrosine and tryptophan biosynthesis (24)
- Glycosphingolipid biosynthesis - globo series (22)
- Fatty acid elongation in mitochondria (21)
- Fatty acid biosynthesis (18)
- Lysine biosynthesis (16)
- Thiamine metabolism (16)
- Cyanoamino acid metabolism (15)
- Protein export (15)
- Vitamin B6 metabolism (15)
- Ubiquinone and other terpenoid-quinone biosynthesis (14)
- D-Glutamine and D-glutamate metabolism (13)
- Lipoic acid metabolism (6)
- O-Mannosyl glycan biosynthesis (6)
- D-Arginine and D-ornithine metabolism (2)