Germany
Japan
United Kingdom
China
ASH2L (Myc-DDK-tagged)-Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, ASH2L (Myc-DDK tagged) - Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, ASH2L (mGFP-tagged) - Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
ASH2L (GFP-tagged) - Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ASH2L (Myc-DDK tagged) - Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ASH2L (mGFP-tagged) - Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ASH2L (Myc-DDK-tagged)-Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of ASH2L (Myc-DDK-tagged)-Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ASH2L (Myc-DDK-tagged)-Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of ASH2L (mGFP-tagged)-Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ASH2L (mGFP-tagged)-Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ASH2L (Myc-DDK tagged) - Homo sapiens ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ASH2L (myc-DDK-tagged) - Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ASH2L (GFP-tagged) - Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ASH2L (GFP-tagged) - Homo sapiens ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal ASH2 Antibody
| Applications | ELISA, IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASH2 antibody: mouse Ash2 (absent, small, or homeotic 2), using 3 different KLH-conjugated synthetic peptides, 2 containing an amino acid sequence from the central and 1 containing an amino acid sequence from the C-terminal part of |
Lenti ORF clone of Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-ASH2L Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASH2L antibody: synthetic peptide directed towards the N terminal of human ASH2L. Synthetic peptide located within the following region: AAGAAAPPGEGISAAPTVEPSSGEAEGGEANLVDVSGGLETESSNGKDTL |
Rabbit Polyclonal ASH2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASH2 antibody: human Ash2 (absent, small, or homeotic 2), using a recombinant protein. |
Rabbit Polyclonal ASH2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASH2 antibody: human Ash2 (absent, small, or homeotic 2), using a recombinant protein. |
Lenti ORF clone of Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
ASH2L (untagged)-Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-ASH2L Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ASH2L Antibody: synthetic peptide directed towards the middle region of human ASH2L. Synthetic peptide located within the following region: AAGSSGKGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFN |
Rabbit Polyclonal Anti-ASH2L Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ASH2L Antibody: synthetic peptide directed towards the N terminal of human ASH2L. Synthetic peptide located within the following region: EPSSGEAEGGEANLVDVSGGLETESSNGKDTLEGAGDTSEVMDTQAGSVD |
Transient overexpression lysate of ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-ASH2L Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ASH2L Antibody: synthetic peptide directed towards the N terminal of human ASH2L. Synthetic peptide located within the following region: EPSSGEAEGGEANLVDVSGGLETESSNGKDTLEGAGDTSEVMDTQAGSVD |
Carrier-free (BSA/glycerol-free) ASH2L mouse monoclonal antibody,clone OTI1A4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ASH2L HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
ASH2L MS Standard C13 and N15-labeled recombinant protein (NP_004665)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
ASH2L (GFP-tagged) - Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ASH2L (untagged)-Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 2
| Vector | pCMV6 series |
| Tag | Tag Free |
ASH2L (untagged) - Homo sapiens ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
ASH2L (untagged) - Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-ASH2L Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ASH2L |
USD 420.00
2 Weeks
ASH2L mouse monoclonal antibody,clone OTI1A4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
ASH2L mouse monoclonal antibody,clone OTI1A4, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
ASH2L mouse monoclonal antibody,clone OTI1A4, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ASH2L mouse monoclonal antibody,clone OTI1A4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
Active filters
Target Symbol
- ASH2L
Families
- Druggable Genome