Rabbit polyclonal anti-CIITA antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen used for this study was a bacterially produced recombinant FLAG-CIITA corresponding to amino acids 1 through 333 of the human protein. |
Rabbit polyclonal anti-RFX5 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | RFX5 peptide corresponding to a region at amino acids 320 to 494 of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Mouse Anti-Human CD40 Purified (100 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
Rat Anti-Human/Mouse CD45R (B220) Purified (100 ug)
| Applications | FC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit polyclonal LCK Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This LCK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 23-52 amino acids from the N-terminal region of human LCK. |
Rabbit Polyclonal CD19 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD19 |
Rabbit Polyclonal CD19 (Tyr531) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD19 around the phosphorylation site of Tyrosine 531 |
| Modifications | Phospho-specific |
Rabbit anti-IL2RG Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IL2RG |
Rabbit anti-RAG2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human RAG2 |
Rabbit Polyclonal Anti-CD40LG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN |
Rabbit Polyclonal Anti-IGLL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IGLL1 antibody: synthetic peptide directed towards the N terminal of human IGLL1. Synthetic peptide located within the following region: RSRWGRFLLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKAT |
Rabbit Polyclonal Anti-CD40 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD |
Rabbit Polyclonal Anti-CD40 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV |
Rabbit Polyclonal Anti-CD8B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD8B antibody: synthetic peptide directed towards the N terminal of human CD8B. Synthetic peptide located within the following region: RIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFI |
Rabbit Polyclonal Anti-CD8B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD8B antibody: synthetic peptide directed towards the middle region of human CD8B. Synthetic peptide located within the following region: KPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCR |
Rabbit Polyclonal Anti-AIRE Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AIRE Antibody: A synthesized peptide derived from human AIRE |
Rabbit Polyclonal Anti-CD8A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD8A Antibody: A synthesized peptide derived from human CD8A |
Rabbit Polyclonal Anti-CD8B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD8B Antibody: A synthesized peptide derived from human CD8B |
Goat Polyclonal Anti-CD4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CD4 Antibody: Peptide with sequence C-KNKEVSVKRVTQDPK, from the internal region of the protein sequence according to NP_000607.1; NP_001181943.1. |
Mouse Monoclonal Anti-CD4 Antibody [9H5A8]
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-CD4 Antibody [8G1B12]
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Goat Polyclonal Anti-CD19 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide within residues 510 aa to the C-terminus of human CD19 produced in E. coli. |
Goat Polyclonal Anti-CD45 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli. |
CD45 (PTPRC) mouse monoclonal antibody, clone BRA-55, Ascites
| Applications | IF, IHC, WB |
| Reactivities | Human |
CD3E mouse monoclonal antibody, clone OKT3, Aff - Purified
| Applications | FC, FN, IHC |
| Reactivities | Human |
CD45 (PTPRC) (CD45RA) mouse monoclonal antibody, clone n.a, FITC, Purified
| Applications | FC, IHC, IP |
| Reactivities | Human |
| Conjugation | FITC |
CD45 (PTPRC) mouse monoclonal antibody, clone PD7/26/16 + 2B11, Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
CD3E mouse monoclonal antibody, clone B-B11, Azide Free
| Applications | FC, FN |
| Reactivities | Human |
CD4 mouse monoclonal antibody, clone B-A1, Purified
| Applications | FC, IHC |
| Reactivities | Human |
CD45 (PTPRC) mouse monoclonal antibody, clone ML2, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
CD45 (PTPRC) (CD45RA) mouse monoclonal antibody, clone MB1, Aff - Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
CD45 (PTPRC) (CD45RB) mouse monoclonal antibody, clone MT4, Aff - Purified
| Applications | FC, IF, IHC |
| Reactivities | Human |
IKK gamma (IKBKG) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human |
CD3D rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide, corresponding to amino acids 21-70 of Human CD3-δ |
CIITA (N-term) rabbit polyclonal antibody, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide - KLH conjugated |
CD8A mouse monoclonal antibody, clone LT8, Azide Free
| Applications | FC, IHC, IP |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone LT8, Purified
| Applications | FC, IHC, IP |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone LT8, Purified
| Applications | FC, IHC, IP |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone LT8, Purified
| Applications | FC, IHC, IP |
| Reactivities | Human, Monkey |
CD3E mouse monoclonal antibody, clone MEM-57, Low Endotoxin
| Applications | FC, FN, IP |
| Reactivities | Human |
Rabbit Polyclonal Antibody against CD19 (C-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD19 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 393-421 amino acids from the C-terminal region of human CD19. |
Rabbit Polyclonal Antibody against CD8A (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 150-180 amino acids from the C-terminal region of human CD8A. |
Germany
Japan
United Kingdom
China
