Germany
Japan
United Kingdom
China
ARHGEF1 (GFP-tagged) - Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadArhgef1 (Myc-DDK-tagged ORF) - Rat Rho guanine nucleotide exchange factor (GEF) 1 (Arhgef1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Arhgef1 (Myc-DDK-tagged ORF) - Rat Rho guanine nucleotide exchange factor (GEF) 1 (Arhgef1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Arhgef1 (Myc-DDK-tagged ORF) - Rat Rho guanine nucleotide exchange factor (GEF) 1 (Arhgef1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Arhgef1 (mGFP-tagged ORF) - Rat Rho guanine nucleotide exchange factor (GEF) 1 (Arhgef1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Arhgef1 (GFP-tagged ORF) - Rat Rho guanine nucleotide exchange factor (GEF) 1 (Arhgef1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Arhgef1 (untagged) - Mouse Rho guanine nucleotide exchange factor (GEF) 1 (Arhgef1), transcript variant 5, (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ARHGEF1 (untagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 2
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
ARHGEF1 (untagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 2
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit polyclonal anti-ARHGEF1 antibody
| Applications | WB |
| Reactivities | Human Mouse Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ARHGEF1. |
ARHGEF1 - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
ARHGEF1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
ARHGEF1 (untagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 3
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-ARHGEF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARHGEF1 antibody is: synthetic peptide directed towards the N-terminal region of Human ARHGEF1. Synthetic peptide located within the following region: SAAVVNAIGLYMRHLGVRTKSGDKKSGRNFFRKKVMGNRRSDEPAKTKKG |
ARHGEF1 CRISPRa kit - CRISPR gene activation of human Rho guanine nucleotide exchange factor 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Arhgef1 CRISPRa kit - CRISPR gene activation of mouse Rho guanine nucleotide exchange factor (GEF) 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene ARHGEF1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Homo sapiens gene ARHGEF1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene ARHGEF1
ARHGEF1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
ARHGEF1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Transient overexpression lysate of Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
qPCR primer pairs and template standards against Mus musculus gene Arhgef1
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against mus musculus gene Arhgef1
ARHGEF1 MS Standard C13 and N15-labeled recombinant protein (NP_945353)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Arhgef1 (untagged ORF) - Rat Rho guanine nucleotide exchange factor (GEF) 1 (Arhgef1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1) transcript variant 3 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1) transcript variant 2 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1) transcript variant 1 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
ARHGEF1 (untagged)-Human Rho guanine nucleotide exchange factor (GEF) 1 (ARHGEF1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ARHGEF1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Arhgef1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Arhgef1 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal Anti-ARHGEF1 Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ARHGEF1 |
ARHGEF1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ARHGEF1 |
ARHGEF1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ARHGEF1 |
Transient overexpression of ARHGEF1 (NM_198977) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ARHGEF1 (NM_004706) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ARHGEF1 (NM_199002) in HEK293T cells paraffin embedded controls for ICC/IHC staining
ARHGEF1 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Arhgef1 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Arhgef1 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Arhgef1 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Arhgef1 - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Purified recombinant protein of Mouse Rho guanine nucleotide exchange factor (GEF) 1 (Arhgef1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
| Tag | C-MYC/DDK |
| Expression Host | HEK293T |
ARHGEF1 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Arhgef1 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Arhgef1 - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Active filters
Target Symbol
- ARHGEF1