Rabbit polyclonal MAPKAP Kinase 2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Immunogen: This antibody was affinity purified from whole rabbit serum prepared by repeated immunizations with a synthetic peptide corresponding to aa 310-325 of rabbit MAPKAP Kinase 2 conjugated to KLH using maleimide. A terminal cysteine residue was added to facilitate coupling. |
Rabbit Polyclonal Anti-MAPKAPK2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAPKAPK2 antibody is: synthetic peptide directed towards the C-terminal region of Human MAPKAPK2. Synthetic peptide located within the following region: MNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDVKGCLHDKNSDQATWLTR |
Rabbit Polyclonal Anti-MAPKAPK2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAPKAPK2 antibody: synthetic peptide directed towards the middle region of human MAPKAPK2. Synthetic peptide located within the following region: KLTDFGFAKETTQNALQTPCYTPYYVAPEVLGPEKYDKSCDMWSLGVIMY |
MAPKAPK2 - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
USD 1,395.00
5 Weeks
MAPKAPK2 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
MAPKAPK2 CRISPRa kit - CRISPR gene activation of human MAPK activated protein kinase 2
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Mapkapk2 CRISPRa kit - CRISPR gene activation of mouse MAP kinase-activated protein kinase 2
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene MAPKAPK2
| Application | Plasmid of exact quantity for transcript copy number calculation |
MAPKAPK2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qPCR primer pairs and template standards against Mus musculus gene Mapkapk2
| Application | Plasmid of exact quantity for transcript copy number calculation |
MAPKAPK2 MS Standard C13 and N15-labeled recombinant protein (NP_116584)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
MAPKAPK2 MS Standard C13 and N15-labeled recombinant protein (NP_004750)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Mapkapk2 (untagged ORF) - Rat mitogen-activated protein kinase-activated protein kinase 2 (Mapkapk2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2) transcript variant 2 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
MAPKAPK2 (untagged)-Human mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Mapkapk2 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Mapkapk2 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal Anti-MAPKAPK2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MAPKAPK2 |
MAPKAPK2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human MAPKAPK2 (NP_116584.2). |
| Modifications | Unmodified |
Phospho-MAPKAPK2-T334 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around T334 of human MAPKAPK2 (NP_116584.2). |
| Modifications | Phospho T334 |
MAPKAPK-2 (Phospho-T334) polyclonal antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phosphopeptide derived from human MAPKAPK-2 around the phosphorylation site of Threonine 334. |
Transient overexpression of MAPKAPK2 (NM_032960) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MAPKAPK2 (NM_004759) in HEK293T cells paraffin embedded controls for ICC/IHC staining
MAPKAPK2 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Mapkapk2 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Mapkapk2 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Mapkapk2 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Mapkapk2 - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Purified recombinant protein of Mouse MAP kinase-activated protein kinase 2 (Mapkapk2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
| Tag | C-MYC/DDK |
| Expression Host | HEK293T |
Mapkapk2 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Mapkapk2 - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Transient overexpression of MAPKAPK2 (NM_032960) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MAPKAPK2 (NM_032960) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MAPKAPK2 (NM_004759) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MAPKAPK2 (NM_004759) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Germany
Japan
United Kingdom
China
