Products

View as table Download

Recombinant protein of human actinin, alpha 1 (ACTN1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T

ACTN1 (GFP-tagged) - Human actinin, alpha 1 (ACTN1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human actinin, alpha 1 (ACTN1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ACTN1 (Myc-DDK tagged) - Human actinin, alpha 1 (ACTN1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

ACTN1 (Myc-DDK-tagged)-Human actinin, alpha 1 (ACTN1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, ACTN1 (Myc-DDK-tagged)-Human actinin, alpha 1 (ACTN1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

ACTN1 (Myc-DDK-tagged)-Human actinin, alpha 1 (ACTN1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, ACTN1 (Myc-DDK-tagged)-Human actinin, alpha 1 (ACTN1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

ACTN1 (GFP-tagged) - Human actinin, alpha 1 (ACTN1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ACTN1 (GFP-tagged) - Human actinin, alpha 1 (ACTN1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ

Rabbit anti-ACTN1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Monkey
Conjugation Unconjugated
Immunogen Recombinant protein of human ACTN1

ACTN1 (untagged)-Human actinin, alpha 1 (ACTN1), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

alpha Actinin (ACTN1) mouse monoclonal antibody, clone SA-20, Purified

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rabbit, Rat

Rabbit Monoclonal Antibody against ACTN1 (Clone EP2527Y)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Lenti ORF clone of Human actinin, alpha 1 (ACTN1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Rabbit polyclonal anti-ACTN1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human ACTN1.

ACTN1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

ACTN1 (untagged)-Human actinin, alpha 1 (ACTN1), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

alpha Actinin (ACTN1) (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human ACTN1

ACTN1 (aa596-609) Goat Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Internal region (TPQEINGKWDHVRQ)

Carrier-free (BSA/glycerol-free) alpha-actinin mouse monoclonal antibody, clone OTI7A4 (formerly 7A4)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ACTN1 MS Standard C13 and N15-labeled recombinant protein (NP_001093)

Tag C-Myc/DDK
Expression Host HEK293

Anti-ACTN1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to N terminal 2470 amino acids of human actinin, alpha 1

alpha-actinin (Actinin alpha 1) mouse monoclonal antibody, clone OTI7A4 (formerly 7A4)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

alpha-actinin (Actinin alpha 1) mouse monoclonal antibody, clone OTI7A4 (formerly 7A4), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

alpha-actinin (Actinin alpha 1) mouse monoclonal antibody, clone OTI7A4 (formerly 7A4), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

alpha-actinin (Actinin alpha 1) mouse monoclonal antibody, clone OTI7A4 (formerly 7A4)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Transient overexpression of ACTN1 (NM_001102) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of ACTN1 (NM_001130005) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of ACTN1 (NM_001130004) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of ACTN1 (NM_001102) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of ACTN1 (NM_001102) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of ACTN1 (NM_001130005) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack