ACTN1 (Myc-DDK-tagged)-Human actinin, alpha 1 (ACTN1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ACTN1 (Myc-DDK-tagged)-Human actinin, alpha 1 (ACTN1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human actinin, alpha 1 (ACTN1), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
USD 1,150.00
3 Weeks
Lenti ORF particles, ACTN1 (Myc-DDK tagged) - Human actinin, alpha 1 (ACTN1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 1,150.00
6 Weeks
Lenti ORF particles, ACTN1 (mGFP-tagged) - Human actinin, alpha 1 (ACTN1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
ACTN1 (GFP-tagged) - Human actinin, alpha 1 (ACTN1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human actinin, alpha 1 (ACTN1), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,150.00
5 Weeks
Lenti ORF particles, ACTN1 (Myc-DDK tagged) - Human actinin, alpha 1 (ACTN1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,150.00
3 Weeks
Lenti ORF particles, ACTN1 (mGFP-tagged) - Human actinin, alpha 1 (ACTN1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ACTN1 (Myc-DDK-tagged)-Human actinin, alpha 1 (ACTN1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of ACTN1 (Myc-DDK-tagged)-Human actinin, alpha 1 (ACTN1), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,390.00
8 Weeks
Lenti ORF particles, ACTN1 (Myc-DDK-tagged)-Human actinin, alpha 1 (ACTN1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ACTN1 (mGFP-tagged)-Human actinin, alpha 1 (ACTN1), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,390.00
8 Weeks
Lenti ORF particles, ACTN1 (mGFP-tagged)-Human actinin, alpha 1 (ACTN1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ACTN1 (Myc-DDK-tagged)-Human actinin, alpha 1 (ACTN1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of ACTN1 (Myc-DDK-tagged)-Human actinin, alpha 1 (ACTN1), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,410.00
8 Weeks
Lenti ORF particles, ACTN1 (Myc-DDK-tagged)-Human actinin, alpha 1 (ACTN1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of ACTN1 (mGFP-tagged)-Human actinin, alpha 1 (ACTN1), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,410.00
8 Weeks
Lenti ORF particles, ACTN1 (mGFP-tagged)-Human actinin, alpha 1 (ACTN1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ACTN1 (GFP-tagged) - Human actinin, alpha 1 (ACTN1), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ACTN1 (GFP-tagged) - Human actinin, alpha 1 (ACTN1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ |
Rabbit anti-ACTN1 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Monkey |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human ACTN1 |
Lenti ORF clone of Human actinin, alpha 1 (ACTN1), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
ACTN1 (untagged)-Human actinin, alpha 1 (ACTN1), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Alpha-actinin-1 / ACTN1 mouse monoclonal antibody, clone AT1D10, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
Alpha-actinin-1 / ACTN1 mouse monoclonal antibody, clone AT1D10, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
alpha Actinin (ACTN1) mouse monoclonal antibody, clone SA-20, Purified
Applications | IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rabbit, Rat |
Rabbit Monoclonal Antibody against ACTN1 (Clone EP2527Y)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Lenti ORF clone of Human actinin, alpha 1 (ACTN1), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-ACTN1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human ACTN1. |
ACTN1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
ACTN1 (untagged)-Human actinin, alpha 1 (ACTN1), transcript variant 2
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
alpha Actinin (ACTN1) (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human ACTN1 |
ACTN1 (aa596-609) Goat Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Internal region (TPQEINGKWDHVRQ) |
Carrier-free (BSA/glycerol-free) alpha-actinin mouse monoclonal antibody, clone OTI7A4 (formerly 7A4)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression lysate of actinin, alpha 1 (ACTN1), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
ACTN1 MS Standard C13 and N15-labeled recombinant protein (NP_001093)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
ACTN1 (untagged)-Human actinin, alpha 1 (ACTN1), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
ACTN1 (untagged)-Human actinin, alpha 1 (ACTN1), transcript variant 1
Vector | pCMV6 series |
Tag | Tag Free |
Anti-ACTN1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 2470 amino acids of human actinin, alpha 1 |
alpha-actinin (Actinin alpha 1) mouse monoclonal antibody, clone OTI7A4 (formerly 7A4)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
alpha-actinin (Actinin alpha 1) mouse monoclonal antibody, clone OTI7A4 (formerly 7A4), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
alpha-actinin (Actinin alpha 1) mouse monoclonal antibody, clone OTI7A4 (formerly 7A4), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
alpha-actinin (Actinin alpha 1) mouse monoclonal antibody, clone OTI7A4 (formerly 7A4)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of ACTN1 (NM_001102) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ACTN1 (NM_001130005) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ACTN1 (NM_001130004) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ACTN1 (NM_001102) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ACTN1 (NM_001102) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of ACTN1 (NM_001130005) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack