Products

View as table Download

Lenti ORF particles, SOD1 (Myc-DDK tagged) - Human superoxide dismutase 1, soluble (SOD1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit anti-SOD1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SOD1

Rabbit Polyclonal Anti-SOD1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SOD1 antibody is: synthetic peptide directed towards the C-terminal region of Human SOD1. Synthetic peptide located within the following region: DVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLA

Superoxide Dismutase 1 / SOD1 (1-154) human recombinant protein, 0.5 mg

Expression Host E. coli

Superoxide Dismutase 1 / SOD1 (1-154) human recombinant protein, 0.1 mg

Expression Host E. coli

Anti-SOD1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 2-159 amino acids of human superoxide dismutase 1, soluble

Rabbit Polyclonal Anti-SOD1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SOD1 Antibody: Synthetic peptide from SOD1

Purified recombinant protein of Human superoxide dismutase 1, soluble (SOD1), full length, with N-terminal His tag, expressed in E. coli, 50ug

Tag N-His
Expression Host E. coli

Superoxide Dismutase 1 (SOD1) rabbit polyclonal antibody, Purified

Applications IHC, IP, WB
Reactivities Equine, Guinea Pig, Human, Mouse, Rat
Immunogen Synthetic peptide surrounding amino acid 131 of Human SOD

Rabbit polyclonal SOD (Cu/Zn) Antibody

Applications IF, WB
Reactivities Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Xenopus, Dog, Pig, Coral
Conjugation Unconjugated
Immunogen Human Cu/Zn SOD

Rabbit Polyclonal Anti-SOD1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SOD1 antibody: synthetic peptide directed towards the N terminal of human SOD1. Synthetic peptide located within the following region: MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE

Superoxide Dismutase 1 (SOD1) (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human SOD1

Transient overexpression lysate of superoxide dismutase 1, soluble (SOD1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

SOD1 MS Standard C13 and N15-labeled recombinant protein (NP_000445)

Tag C-Myc/DDK
Expression Host HEK293

Goat Polyclonal Antibody against SOD1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-SRKHGGPKDEERH, from the internal region of the protein sequence according to NP_000445.1.

Carrier-free (BSA/glycerol-free) SOD1 mouse monoclonal antibody, clone OTI8B10 (formerly 8B10)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

SOD1 (Superoxide Dismutase 1) mouse monoclonal antibody, clone OTI8B10 (formerly 8B10)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

SOD1 mouse monoclonal antibody, clone 8B10, Biotinylated

Applications FC, IHC, WB
Reactivities Human
Conjugation Biotin

SOD1 (Superoxide Dismutase 1) mouse monoclonal antibody, clone OTI8B10 (formerly 8B10)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Transient overexpression of SOD1 (NM_000454) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Recombinant protein of human superoxide dismutase 1, soluble (SOD1)

Tag N-His
Expression Host E. coli

Recombinant protein of human superoxide dismutase 1, soluble (SOD1)

Tag N-His
Expression Host E. coli

Recombinant protein of human superoxide dismutase 1, soluble (SOD1)

Tag N-His
Expression Host E. coli

Transient overexpression of SOD1 (NM_000454) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of SOD1 (NM_000454) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack