Germany
Japan
United Kingdom
China
Products
Phospho-RAC1-S71 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S71 of human RAC1 |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal JNK1/2/3 (Thr183+Tyr185) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 around the phosphorylation site of Threonine 183+Tyrosine 185 |
| Modifications | Phospho-specific |
Mouse Monoclonal anti-Syk Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal SYK (Tyr348) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human SYK around the phosphorylation site of Tyrosine 348 |
| Modifications | Phospho-specific |
Rabbit polyclonal antibody to PLA2G3 (phospholipase A2, group III)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 263 and 502 of PLA2G3 (Uniprot ID#Q9NZ20) |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit Anti-p38 MAPK (Thr180/Tyr182) Antibody (Phospho-Specific)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic phospho-peptide corresponding to amino acid residues surrounding Thr180/Tyr182 conjugated to KLH |
| Modifications | Phospho-specific |
Anti-RAC2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 50-192 amino acids of human ras-related C3 botulinum toxin substrate 2 (rho family, small GTP binding protein Rac2) |
Rabbit Polyclonal Antibody against PIK3CA (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA. |
Rabbit polyclonal MAP2K7 (Ser271) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP2K7 around the phosphorylation site of serine 271 (V-D-SP-K-A). |
| Modifications | Phospho-specific |
Rabbit polyclonal GRB2 (Ab-159) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GRB2 around the phosphorylation site of serine 159 (K-S-SP-A-P). |
Rabbit Polyclonal Antibody against RAC1 (S71)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 49-78 amino acids from human RAC1. |
Rabbit Polyclonal PI3-kinase p85- alpha (Tyr607) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human PI3-kinase p85- alpha around the phosphorylation site of Tyrosine 607 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-RAC1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAC1 antibody: synthetic peptide directed towards the middle region of human RAC1. Synthetic peptide located within the following region: LAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL |
RAF1 pSer621 mouse monoclonal antibody, clone 6B4, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
| Modifications | Phospho-specific |
Rabbit polyclonal SOS2 Antibody (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SOS2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 188-215 amino acids from the N-terminal region of human SOS2. |
Rabbit Polyclonal JNK1/2/3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 |
Rabbit polyclonal p38 MAPK (Ab-322) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human p38 MAPK around the phosphorylation site of tyreonine 322 (D-P-Y-D-Q). |
Rabbit polyclonal p38 Antibody
| Applications | WB |
| Reactivities | Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Pig |
| Conjugation | Unconjugated |
| Immunogen | A 20 residue synthetic peptide based on the human p38 with the cysteine residue added and coupled to KLH. |
Rabbit Polyclonal Anti-MAPK10 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat, Tobacco hornworm |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Mapk10 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: RYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYREL |
Active filters
Category
-
Antibodies
- Primary Antibodies
Pathways
- Fc epsilon RI signaling pathway
Filter by
Target Symbol
- MAP2K1 (237)
- MAP2K3 (158)
- AKT1 (127)
- MAPK13 (99)
- MAPK1 (74)
- BTK (71)
- PIK3CG (64)
- PRKCE (64)
- TNF (60)
- CSF2 (59)
- KRAS (58)
- MAPK8 (55)
- HRAS (47)
- PIK3R5 (47)
- AKT2 (44)
- MAPK14 (41)
- MAP2K4 (38)
- PIK3CD (35)
- MAP2K2 (34)
- RAF1 (33)
- MAPK9 (31)
- PRKCA (27)
- PIK3CA (25)
- IL4 (23)
- MAPK3 (23)
- AKT3 (19)
- MAPK10 (19)
- PLA2G3 (19)
- PRKCD (19)
- SYK (18)
- NRAS (17)
- IL3 (15)
- PLCG1 (15)
- PIK3R1 (14)
- PLA2G6 (13)
- FYN (12)
- PRKCB (12)
- GRB2 (11)
- IL13 (11)
- GAB2 (10)
- MAP2K6 (10)
- VAV1 (10)
- LAT (9)
- MAPK12 (9)
- PLCG2 (9)
- IL5 (8)
- INPP5D (8)
- LYN (7)
- MAPK11 (7)
- PDK1 (7)
- PLA2G2A (7)
- FCER1A (6)
- LCP2 (6)
- RAC1 (6)
- MAP2K7 (5)
- PLA2G4A (5)
- PIK3CB (4)
- PIK3R3 (4)
- VAV3 (4)
- PLA2G5 (3)
- SOS2 (3)
- VAV2 (3)
- JMJD7-PLA2G4B (2)
- PIK3R2 (2)
- PLA2G12A (2)
- PLA2G4E (2)
- RAC2 (2)
- SOS1 (2)
- FCER1G (1)
- PLA2G12B (1)
- PLA2G1B (1)
- PLA2G2C (1)
- PLA2G2D (1)
- PLA2G2E (1)
Reactivities
- Human (1776)
- Mouse (1527)
- Rat (1492)
- Dog (516)
- Monkey (452)
- Bovine (18)
- Pig (15)
- Chicken (14)
- Cow (10)
- Xenopus (9)
- Rabbit (5)
- Canine (4)
- Drosophila (4)
- Hamster (4)
- Rhesus Monkey (3)
- C. elegans (2)
- Canis (2)
- Guinea Pig (2)
- Macaque (2)
- Primate (2)
- Sheep (2)
- X. tropicalis (2)
- Chimpanzee (1)
- Fish (1)
- Gibbon (1)
- Gorilla (1)
- Horse (1)
- Porcine (1)
- Tobacco hornworm (1)
- Zebrafish (1)