USD 98.00
USD 390.00
In Stock
SOD1 (Myc-DDK-tagged)-Human superoxide dismutase 1, soluble (SOD1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 98.00
USD 390.00
In Stock
SOD1 (Myc-DDK-tagged)-Human superoxide dismutase 1, soluble (SOD1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SOD1 (untagged)-Human superoxide dismutase 1, soluble (SOD1)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Recombinant protein of human superoxide dismutase 1, soluble (SOD1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, SOD1 (Myc-DDK tagged) - Human superoxide dismutase 1, soluble (SOD1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, SOD1 (mGFP-tagged) - Human superoxide dismutase 1, soluble (SOD1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
SOD1 (GFP-tagged) - Human superoxide dismutase 1, soluble (SOD1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human superoxide dismutase 1, soluble (SOD1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, SOD1 (Myc-DDK tagged) - Human superoxide dismutase 1, soluble (SOD1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human superoxide dismutase 1, soluble (SOD1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, SOD1 (mGFP-tagged) - Human superoxide dismutase 1, soluble (SOD1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit anti-SOD1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SOD1 |
Lenti ORF clone of Human superoxide dismutase 1, soluble (SOD1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-SOD1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SOD1 antibody is: synthetic peptide directed towards the C-terminal region of Human SOD1. Synthetic peptide located within the following region: DVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLA |
Superoxide Dismutase 1 / SOD1 (1-154) human recombinant protein, 0.5 mg
Expression Host | E. coli |
Superoxide Dismutase 1 / SOD1 (1-154) human recombinant protein, 0.1 mg
Expression Host | E. coli |
SOD1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Anti-SOD1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 2-159 amino acids of human superoxide dismutase 1, soluble |
Rabbit Polyclonal Anti-SOD1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SOD1 Antibody: Synthetic peptide from SOD1 |
Purified recombinant protein of Human superoxide dismutase 1, soluble (SOD1), full length, with N-terminal His tag, expressed in E. coli, 50ug
Tag | N-His |
Expression Host | E. coli |
Superoxide Dismutase 1 (SOD1) rabbit polyclonal antibody, Purified
Applications | IHC, IP, WB |
Reactivities | Equine, Guinea Pig, Human, Mouse, Rat |
Immunogen | Synthetic peptide surrounding amino acid 131 of Human SOD |
Lenti ORF clone of Human superoxide dismutase 1, soluble (SOD1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal SOD (Cu/Zn) Antibody
Applications | IF, WB |
Reactivities | Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Xenopus, Dog, Pig, Coral |
Conjugation | Unconjugated |
Immunogen | Human Cu/Zn SOD |
Rabbit Polyclonal Anti-SOD1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SOD1 antibody: synthetic peptide directed towards the N terminal of human SOD1. Synthetic peptide located within the following region: MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE |
Superoxide Dismutase 1 (SOD1) (Center) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human SOD1 |
Transient overexpression lysate of superoxide dismutase 1, soluble (SOD1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
SOD1 MS Standard C13 and N15-labeled recombinant protein (NP_000445)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Goat Polyclonal Antibody against SOD1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SRKHGGPKDEERH, from the internal region of the protein sequence according to NP_000445.1. |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) SOD1 mouse monoclonal antibody, clone OTI8B10 (formerly 8B10)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 379.00
In Stock
SOD1 (Superoxide Dismutase 1) mouse monoclonal antibody, clone OTI8B10 (formerly 8B10)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
5 Days
SOD1 mouse monoclonal antibody, clone 8B10, Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
5 Days
SOD1 mouse monoclonal antibody, clone 8B10, HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
USD 159.00
2 Days
SOD1 (Superoxide Dismutase 1) mouse monoclonal antibody, clone OTI8B10 (formerly 8B10)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Transient overexpression of SOD1 (NM_000454) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Recombinant protein of human superoxide dismutase 1, soluble (SOD1)
Tag | N-His |
Expression Host | E. coli |
Recombinant protein of human superoxide dismutase 1, soluble (SOD1)
Tag | N-His |
Expression Host | E. coli |
Recombinant protein of human superoxide dismutase 1, soluble (SOD1)
Tag | N-His |
Expression Host | E. coli |
Recombinant protein of human superoxide dismutase 1, soluble (SOD1)
Tag | N-His |
Expression Host | E. coli |
Transient overexpression of SOD1 (NM_000454) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SOD1 (NM_000454) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack