OGT Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human OGT |
OGT Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human OGT |
Rabbit Polyclonal Anti-GCNT3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GCNT3 Antibody: synthetic peptide directed towards the C terminal of human GCNT3. Synthetic peptide located within the following region: AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL |
Rabbit Polyclonal antibody to O-GlcNAc transferase (O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase))
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 223 and 502 of O-GlcNAc transferase (Uniprot ID#O15294) |
Rabbit polyclonal antibody to ST3GAL1 (ST3 beta-galactoside alpha-2,3-sialyltransferase 1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 195 of SIAT4A (Uniprot ID#Q11201) |
Goat Polyclonal Antibody against OGT
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-YEHPKDLKLSDGR, from the internal region of the protein sequence according to NP_858058.1; NP_858059.1. |
Rabbit Polyclonal Anti-GALNT9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GALNT9 antibody is: synthetic peptide directed towards the C-terminal region of Human GALNT9. Synthetic peptide located within the following region: DFGDVSERLALRQRLKCRSFKWYLENVYPEMRVYNNTLTYGEVRNSKASA |
Goat Polyclonal Antibody against GCNT3 (aa 410 to 422)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-NKFDPKVDDNALQ, from the internal region (near C terminus) of the protein sequence according to NP_004742.1. |
Rabbit Polyclonal antibody to GALNT7 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 7 (GalNAc-T7))
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 24 and 515 of GALNT7 (Uniprot ID#Q86SF2) |
Rabbit polyclonal anti-GCNT3 antibody
Applications | IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GCNT3. |
Rabbit Polyclonal Anti-GALNT10 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GALNT10 antibody: synthetic peptide directed towards the N terminal of human GALNT10. Synthetic peptide located within the following region: VPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVAVQKKLRSS |
Rabbit Polyclonal GALNT10 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | GALNT10 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human GALNT10. |
Rabbit Polyclonal GALNT10 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | GALNT10 antibody was raised against a 16 amino acid peptide near the amino terminus of human GALNT10. |
Rabbit Polyclonal antibody to GALNT2 (UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2 (GalNAc-T2))
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 55 and 369 of GALNT2 (Uniprot ID#Q10471) |
Rabbit polyclonal anti-B4GALT5 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human B4GALT5. |
Rabbit Polyclonal antibody to ST3GAL2 (ST3 beta-galactoside alpha-2,3-sialyltransferase 2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 68 and 327 of ST3GAL2 (Uniprot ID#Q16842) |
Rabbit Polyclonal antibody to O-GlcNAc transferase (O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase))
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 280 of O-GlcNAc transferase (Uniprot ID#O15294) |
Rabbit polyclonal C1GALT1 Antibody (Center)
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This C1GALT1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 115-144 amino acids from the Central region of human C1GALT1. |
Rabbit polyclonal Anti-OGT Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-OGT antibody: synthetic peptide directed towards the N terminal of human OGT. Synthetic peptide located within the following region: ASSVGNVADSTEPTKRMLSFQGLAELAHREYQAGDFEAAERHCMQLWRQE |
Rabbit Polyclonal Anti-GALNT6 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GALNT6 antibody: synthetic peptide directed towards the N terminal of human GALNT6. Synthetic peptide located within the following region: MNNLRDSMPKLQIRAPEAQQTLFSINQSCLPGFYTPAELKPFWERPPQDP |
Goat Polyclonal Antibody against GCNT3 (aa 273 to 284)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RDTLHLTNKKKD, from the internal region of the protein sequence according to NP_004742.1. |
Rabbit polyclonal anti-B3GNT6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-B3GNT6 antibody is: synthetic peptide directed towards the C-terminal region of Human B3GNT6. Synthetic peptide located within the following region: CSGGGFLLSGLAPSGHEGIRPFGVQLPGAQQSSFDPCMYRELLLVHRFAP |
Rabbit polyclonal Anti-GALNTL4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GALNTL4 antibody: synthetic peptide directed towards the middle region of human GALNTL4. Synthetic peptide located within the following region: IIAYGVLQNSLKTDLCLDQGPDTENVPIMYICHGMTPQNVYYTSSQQIHV |
Rabbit Polyclonal Anti-GALNTL6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GALNTL6 Antibody is: synthetic peptide directed towards the N-terminal region of Human GALNTL6. Synthetic peptide located within the following region: EEDHDDSAYRENGFNIFVSNNIALERSLPDIRHANCKHKMYLERLPNTSI |
Rabbit Polyclonal Anti-C1GALT1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-C1GALT1 antibody: synthetic peptide directed towards the middle region of human C1GALT1. Synthetic peptide located within the following region: NVEAGDSRDTIGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGC |
Rabbit Polyclonal Anti-GALNT16 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GALNT16 antibody: synthetic peptide directed towards the N terminal of human GALNT16. Synthetic peptide located within the following region: LSAKQLKAGEDPYRQHAFNQLESDKLSPDRPIRDTRHYSCPSVSYSSDLP |
Rabbit Polyclonal Anti-GALNT14 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GALNT14 antibody: synthetic peptide directed towards the middle region of human GALNT14. Synthetic peptide located within the following region: LEIVPCSRVGHVFRKKHPYVFPDGNANTYIKNTKRTAEVWMDEYKQYYYA |
Rabbit Polyclonal Anti-GCNT3 Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | GCNT3 antibody was raised against synthetic 15 amino acid peptide from N-terminus of human GCNT3. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (93%); Marmoset (80%). |
Rabbit Polyclonal Anti-ST3GAL2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ST3GAL2 antibody: synthetic peptide directed towards the C terminal of human ST3GAL2. Synthetic peptide located within the following region: ADSRGNWHHYWENNRYAGEFRKTGVHDADFEAHIIDMLAKASKIEVYRGN |
Rabbit Polyclonal Anti-GALNT6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GALNT6 antibody: synthetic peptide directed towards the middle region of human GALNT6. Synthetic peptide located within the following region: EIIPCSVVGHVFRTKSPHTFPKGTSVIARNQVRLAEVWMDSYKKIFYRRN |
Rabbit Polyclonal Anti-GALNT5 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GALNT5 antibody: synthetic peptide directed towards the middle region of human GALNT5. Synthetic peptide located within the following region: ELSFKVWMCGGEIEIIPCSRVGHIFRNDNPYSFPKDRMKTVERNLVRVAE |
Rabbit Polyclonal Anti-GALNT13 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GALNT13 antibody: synthetic peptide directed towards the N terminal of human GALNT13. Synthetic peptide located within the following region: CNKCDDKKERSLLPALRAVISRNQEGPGEMGKAVLIPKDDQEKMKELFKI |
Rabbit Polyclonal Anti-GALNT15 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-GALNT15 antibody is: synthetic peptide directed towards the N-terminal region of Human GALNT15. Synthetic peptide located within the following region: LMLGCVLMMVAMLHPPHHTLHQTVTAQASKHSPEARYRLDFGESQDWVLE |
Rabbit Polyclonal Anti-ST6GALNAC1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ST6GALNAC1 antibody: synthetic peptide directed towards the middle region of human ST6GALNAC1. Synthetic peptide located within the following region: LIKGYEQDVGTRTSFYGFTAFSLTQSLLILGNRGFKNVPLGKDVRYLHFL |
Carrier-free (BSA/glycerol-free) GALNT10 mouse monoclonal antibody,clone OTI2A12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) GALNT10 mouse monoclonal antibody,clone OTI4F11
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ST3GAL1 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human ST3GAL1 |
GALNT10 mouse monoclonal antibody,clone OTI2A12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
GALNT10 mouse monoclonal antibody,clone OTI2A12, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
GALNT10 mouse monoclonal antibody,clone OTI2A12, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
GALNT10 mouse monoclonal antibody,clone OTI2A12
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
GALNT10 mouse monoclonal antibody,clone OTI4F11
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
GALNT10 mouse monoclonal antibody,clone OTI4F11, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
GALNT10 mouse monoclonal antibody,clone OTI4F11, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
GALNT10 mouse monoclonal antibody,clone OTI4F11
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |