Products

Antibodies (14)
Proteins (14)
cDNA Clones (11)
Jump to Filters
View as table Download
Superoxide Dismutase 1 (SOD1) (NM_000454) Human Tagged ORF Clone Lentiviral Particle
RC200725L3V

USD 820.00

5 Weeks

Lenti ORF particles, SOD1 (Myc-DDK tagged) - Human superoxide dismutase 1, soluble (SOD1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Superoxide Dismutase 1 (SOD1) Rabbit Polyclonal Antibody
TA326813

USD 275.00

3 Weeks

Rabbit anti-SOD1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SOD1
Superoxide Dismutase 1 (SOD1) Rabbit Polyclonal Antibody
TA343111

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-SOD1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SOD1 antibody is: synthetic peptide directed towards the C-terminal region of Human SOD1. Synthetic peptide located within the following region: DVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLA
Superoxide Dismutase 1 / SOD1 (1-154) Human Protein
AR03033PU-L

USD 845.00

2 Weeks

Superoxide Dismutase 1 / SOD1 (1-154) human recombinant protein, 0.5 mg

Expression Host E. coli
Superoxide Dismutase 1 / SOD1 (1-154) Human Protein
AR03033PU-N

USD 330.00

2 Weeks

Superoxide Dismutase 1 / SOD1 (1-154) human recombinant protein, 0.1 mg

Expression Host E. coli
Superoxide Dismutase 1 (SOD1) Rabbit Polyclonal Antibody
TA321133

USD 345.00

In Stock

Anti-SOD1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 2-159 amino acids of human superoxide dismutase 1, soluble
Superoxide Dismutase 1 (SOD1) Rabbit Polyclonal Antibody
TA347910

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-SOD1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SOD1 Antibody: Synthetic peptide from SOD1
Superoxide Dismutase 1 (SOD1) (NM_000454) Human Recombinant Protein
TP750141

USD 215.00

In Stock

Purified recombinant protein of Human superoxide dismutase 1, soluble (SOD1), full length, with N-terminal His tag, expressed in E. coli, 50ug

Tag N-His
Expression Host E. coli
Superoxide Dismutase 1 (SOD1) Rabbit Polyclonal Antibody
AP22845PU-N

USD 540.00

2 Weeks

Superoxide Dismutase 1 (SOD1) rabbit polyclonal antibody, Purified

Applications IHC, IP, WB
Reactivities Equine, Guinea Pig, Human, Mouse, Rat
Immunogen Synthetic peptide surrounding amino acid 131 of Human SOD
Superoxide Dismutase 1 (SOD1) Rabbit Polyclonal Antibody [Clone ID: N/A]
TA326384

USD 430.00

5 Days

Rabbit polyclonal SOD (Cu/Zn) Antibody

Applications IF, WB
Reactivities Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Xenopus, Dog, Pig, Coral
Conjugation Unconjugated
Immunogen Human Cu/Zn SOD
Superoxide Dismutase 1 (SOD1) Rabbit Polyclonal Antibody
TA338376

USD 310.00

5 Days

Rabbit Polyclonal Anti-SOD1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SOD1 antibody: synthetic peptide directed towards the N terminal of human SOD1. Synthetic peptide located within the following region: MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHE
Superoxide Dismutase 1 (SOD1) (Center) Rabbit Polyclonal Antibody
AP18205PU-N

USD 512.00

2 Weeks

Superoxide Dismutase 1 (SOD1) (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the Center region of human SOD1
Superoxide Dismutase 1 (SOD1) (NM_000454) Human Mass Spec Standard
PH300725

USD 2,055.00

3 Weeks

SOD1 MS Standard C13 and N15-labeled recombinant protein (NP_000445)

Tag C-Myc/DDK
Expression Host HEK293
Superoxide Dismutase 1 (SOD1) Goat Polyclonal Antibody
TA302692

USD 375.00

5 Days

Goat Polyclonal Antibody against SOD1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-SRKHGGPKDEERH, from the internal region of the protein sequence according to NP_000445.1.
Superoxide Dismutase 1 (SOD1) Mouse Monoclonal Antibody [Clone ID: OTI8B10]
CF500495

USD 545.00

3 Days

Carrier-free (BSA/glycerol-free) SOD1 mouse monoclonal antibody, clone OTI8B10 (formerly 8B10)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Superoxide Dismutase 1 (SOD1) Mouse Monoclonal Antibody [Clone ID: OTI8B10]
TA500495

USD 379.00

In Stock

SOD1 (Superoxide Dismutase 1) mouse monoclonal antibody, clone OTI8B10 (formerly 8B10)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: “NEURO15".

Superoxide Dismutase 1 (SOD1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8B10]
TA500495AM

USD 420.00

5 Days

SOD1 mouse monoclonal antibody, clone 8B10, Biotinylated

Applications FC, IHC, WB
Reactivities Human
Conjugation Biotin
Superoxide Dismutase 1 (SOD1) Mouse Monoclonal Antibody [Clone ID: OTI8B10]
TA500495S

USD 159.00

2 Days

SOD1 (Superoxide Dismutase 1) mouse monoclonal antibody, clone OTI8B10 (formerly 8B10)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Superoxide Dismutase 1 (SOD1) ICC Control Block
TB400725

USD 1,040.00

4 Weeks

Transient overexpression of SOD1 (NM_000454) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Superoxide Dismutase 1 (SOD1) (NM_000454) Human Recombinant Protein
TP720521L

USD 1,900.00

3 Weeks

Recombinant protein of human superoxide dismutase 1, soluble (SOD1)

Tag N-His
Expression Host E. coli
Superoxide Dismutase 1 (SOD1) (NM_000454) Human Recombinant Protein
TP720521M

USD 760.00

3 Weeks

Recombinant protein of human superoxide dismutase 1, soluble (SOD1)

Tag N-His
Expression Host E. coli
Superoxide Dismutase 1 (SOD1) (NM_000454) Human Recombinant Protein
TP720521XL

USD 2,800.00

3 Weeks

Recombinant protein of human superoxide dismutase 1, soluble (SOD1)

Tag N-His
Expression Host E. coli
Superoxide Dismutase 1 (SOD1) Cytosection
TS400725

USD 225.00

4 Weeks

Transient overexpression of SOD1 (NM_000454) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Superoxide Dismutase 1 (SOD1) Cytosection
TS400725P5

USD 889.00

4 Weeks

Transient overexpression of SOD1 (NM_000454) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack