Products

cDNA Clones (25)
Antibodies (15)
Proteins (11)
Jump to Filters
View as table Download
alpha Actinin (ACTN1) (NM_001102) Human Tagged ORF Clone
RG204924

USD 830.00

In Stock

ACTN1 (GFP-tagged) - Human actinin, alpha 1 (ACTN1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
alpha Actinin (ACTN1) (NM_001102) Human Tagged ORF Clone
RC204924L4

USD 950.00

In Stock

Lenti ORF clone of Human actinin, alpha 1 (ACTN1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
alpha Actinin (ACTN1) (NM_001102) Human Tagged ORF Clone Lentiviral Particle
RC204924L3V

USD 1,150.00

5 Weeks

Lenti ORF particles, ACTN1 (Myc-DDK tagged) - Human actinin, alpha 1 (ACTN1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
alpha Actinin (ACTN1) (NM_001130005) Human Tagged ORF Clone
RC226236

USD 990.00

5 Weeks

ACTN1 (Myc-DDK-tagged)-Human actinin, alpha 1 (ACTN1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
alpha Actinin (ACTN1) (NM_001130005) Human Tagged ORF Clone Lentiviral Particle
RC226236L3V

USD 1,390.00

8 Weeks

Lenti ORF particles, ACTN1 (Myc-DDK-tagged)-Human actinin, alpha 1 (ACTN1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
alpha Actinin (ACTN1) (NM_001130004) Human Tagged ORF Clone
RC226259

USD 1,010.00

5 Weeks

ACTN1 (Myc-DDK-tagged)-Human actinin, alpha 1 (ACTN1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
alpha Actinin (ACTN1) (NM_001130004) Human Tagged ORF Clone Lentiviral Particle
RC226259L3V

USD 1,410.00

8 Weeks

Lenti ORF particles, ACTN1 (Myc-DDK-tagged)-Human actinin, alpha 1 (ACTN1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
alpha Actinin (ACTN1) (NM_001130005) Human Tagged ORF Clone
RG226236

USD 1,090.00

5 Weeks

ACTN1 (GFP-tagged) - Human actinin, alpha 1 (ACTN1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
alpha Actinin (ACTN1) (NM_001130004) Human Tagged ORF Clone
RG226259

USD 1,110.00

5 Weeks

ACTN1 (GFP-tagged) - Human actinin, alpha 1 (ACTN1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
alpha Actinin (ACTN1) Rabbit Polyclonal Antibody
TA344352

USD 475.00

5 Days

Rabbit Polyclonal Anti-ACTN1 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTN1 antibody: synthetic peptide directed towards the N terminal of human ACTN1. Synthetic peptide located within the following region: DHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQ
alpha Actinin (ACTN1) Rabbit Polyclonal Antibody
TA326960

USD 275.00

3 Weeks

Rabbit anti-ACTN1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Monkey
Conjugation Unconjugated
Immunogen Recombinant protein of human ACTN1
alpha Actinin (ACTN1) (NM_001102) Human Untagged Clone
SC119433

USD 310.00

In Stock

ACTN1 (untagged)-Human actinin, alpha 1 (ACTN1), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
alpha Actinin (ACTN1) Mouse Monoclonal Antibody [Clone ID: SA-20]
AM20694PU-N

USD 405.00

2 Weeks

alpha Actinin (ACTN1) mouse monoclonal antibody, clone SA-20, Purified

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rabbit, Rat
alpha Actinin (ACTN1) Rabbit Monoclonal Antibody [Clone ID: EP2527Y]
TA301137

USD 515.00

In Stock

Rabbit Monoclonal Antibody against ACTN1 (Clone EP2527Y)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
alpha Actinin (ACTN1) (NM_001102) Human Tagged ORF Clone
RC204924L2

USD 950.00

3 Weeks

Lenti ORF clone of Human actinin, alpha 1 (ACTN1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
alpha Actinin (ACTN1) Rabbit Polyclonal Antibody
TA311843

USD 345.00

In Stock

Rabbit polyclonal anti-ACTN1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human ACTN1.
alpha Actinin (ACTN1) (NM_001102) Human Over-expression Lysate
LC400447

USD 121.00

In Stock

ACTN1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
alpha Actinin (ACTN1) (NM_001102) Human Untagged Clone
SC320917

USD 310.00

In Stock

ACTN1 (untagged)-Human actinin, alpha 1 (ACTN1), transcript variant 2

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
alpha Actinin (ACTN1) (N-term) Rabbit Polyclonal Antibody
AP17086PU-N

USD 450.00

2 Weeks

alpha Actinin (ACTN1) (N-term) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human ACTN1
alpha Actinin (ACTN1) Goat Polyclonal Antibody
TA329085

USD 375.00

5 Days

ACTN1 (aa596-609) Goat Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Internal region (TPQEINGKWDHVRQ)
alpha Actinin (ACTN1) Mouse Monoclonal Antibody [Clone ID: OTI7A4]
CF500072

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) alpha-actinin mouse monoclonal antibody, clone OTI7A4 (formerly 7A4)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
alpha Actinin (ACTN1) (NM_001102) Human Over-expression Lysate
LY400447

USD 396.00

5 Days

Transient overexpression lysate of actinin, alpha 1 (ACTN1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
alpha Actinin (ACTN1) (NM_001102) Human Mass Spec Standard
PH304924

USD 2,055.00

3 Weeks

ACTN1 MS Standard C13 and N15-labeled recombinant protein (NP_001093)

Tag C-Myc/DDK
Expression Host HEK293
alpha Actinin (ACTN1) Rabbit Polyclonal Antibody
TA321277

USD 345.00

In Stock

Anti-ACTN1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to N terminal 2470 amino acids of human actinin, alpha 1
alpha Actinin (ACTN1) Mouse Monoclonal Antibody [Clone ID: OTI7A4]
TA500072

USD 379.00

In Stock

alpha-actinin (Actinin alpha 1) mouse monoclonal antibody, clone OTI7A4 (formerly 7A4)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
alpha Actinin (ACTN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7A4]
TA500072AM

USD 420.00

4 Weeks

alpha-actinin (Actinin alpha 1) mouse monoclonal antibody, clone OTI7A4 (formerly 7A4), Biotinylated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
alpha Actinin (ACTN1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7A4]
TA500072BM

USD 420.00

4 Weeks

alpha-actinin (Actinin alpha 1) mouse monoclonal antibody, clone OTI7A4 (formerly 7A4), HRP conjugated

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
alpha Actinin (ACTN1) Mouse Monoclonal Antibody [Clone ID: OTI7A4]
TA500072S

USD 159.00

In Stock

alpha-actinin (Actinin alpha 1) mouse monoclonal antibody, clone OTI7A4 (formerly 7A4)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
alpha Actinin (ACTN1) ICC Control Block
TB404924

USD 1,400.00

4 Weeks

Transient overexpression of ACTN1 (NM_001102) in HEK293T cells paraffin embedded controls for ICC/IHC staining

alpha Actinin (ACTN1) ICC Control Block
TB426236

USD 1,640.00

4 Weeks

Transient overexpression of ACTN1 (NM_001130005) in HEK293T cells paraffin embedded controls for ICC/IHC staining

alpha Actinin (ACTN1) ICC Control Block
TB426259

USD 1,660.00

4 Weeks

Transient overexpression of ACTN1 (NM_001130004) in HEK293T cells paraffin embedded controls for ICC/IHC staining

alpha Actinin (ACTN1) Cytosection
TS404924

USD 225.00

4 Weeks

Transient overexpression of ACTN1 (NM_001102) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

alpha Actinin (ACTN1) Cytosection
TS404924P5

USD 889.00

4 Weeks

Transient overexpression of ACTN1 (NM_001102) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

alpha Actinin (ACTN1) ICC Control Sections
TS426236P5

USD 889.00

4 Weeks

Transient overexpression of ACTN1 (NM_001130005) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack