Germany
Japan
United Kingdom
China
ATG5 (Myc-DDK-tagged)-Human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, ATG5 (Myc-DDK tagged) - Human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, ATG5 (mGFP-tagged) - Human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
ATG5 (myc-DDK-tagged) - Human autophagy related 5 (ATG5), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ATG5 (GFP-tagged) - Human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
ATG5 (myc-DDK-tagged) - Human autophagy related 5 (ATG5), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ATG5 (untagged)-Human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF particles, ATG5 (Myc-DDK tagged) - Human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, ATG5 (mGFP-tagged) - Human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ATG5 (myc-DDK-tagged) - Human autophagy related 5 (ATG5), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ATG5 (myc-DDK-tagged) - Human autophagy related 5 (ATG5), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rabbit Polyclonal Antibody against ATG5
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Porcine, Primate, Xenopus, Zebrafish, Cow, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an N-terminal region (within residues 1-50) of the human ATG5 protein. [Swiss-Prot# Q9H1Y0] |
Lenti ORF clone of Human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
ATG5 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit polyclonal ATG5 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This ATG5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human ATG5. |
Rabbit Polyclonal Anti-ATG5 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ATG5 Antibody: synthetic peptide directed towards the C terminal of human ATG5. Synthetic peptide located within the following region: DPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTD |
Purified recombinant protein of Human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5)
| Tag | tag free |
| Expression Host | E. coli |
ATG5 (incl. pos. control) mouse monoclonal antibody, clone 11C3, Purified
| Applications | WB |
| Reactivities | Canine, Human, Mouse, Rat |
APG5L / ATG5 (1-275, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
APG5L / ATG5 (1-275, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
ATG5 MS Standard C13 and N15-labeled recombinant protein (NP_004840)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Lenti ORF clone of Human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
ATG5 (GFP-tagged) - Human autophagy related 5 (ATG5), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ATG5 (GFP-tagged) - Human autophagy related 5 (ATG5), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ATG5 (GFP-tagged) - Human autophagy related 5 (ATG5), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ATG5 (GFP-tagged) - Human autophagy related 5 (ATG5), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ATG5 (untagged) - Human autophagy related 5 (ATG5), transcript variant 5
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ATG5 (untagged) - Human autophagy related 5 (ATG5), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ATG5 (untagged) - Human autophagy related 5 (ATG5), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
ATG5 (untagged) - Human autophagy related 5 (ATG5), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
Rabbit Polyclonal Anti-ATG5 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ATG5 |
ATG5 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ATG5 |
Transient overexpression of ATG5 (NM_004849) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ATG5 (NM_001286111) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ATG5 (NM_001286107) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ATG5 (NM_001286108) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ATG5 (NM_001286106) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5)
| Tag | tag free |
| Expression Host | E. coli |
Purified recombinant protein of Human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5)
| Tag | tag free |
| Expression Host | E. coli |
Purified recombinant protein of Human ATG5 autophagy related 5 homolog (S. cerevisiae) (ATG5)
| Tag | tag free |
| Expression Host | E. coli |
Transient overexpression of ATG5 (NM_004849) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ATG5 (NM_004849) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- ATG5
Pathways
- Regulation of autophagy