Products

cDNA Clones (22)
Proteins (17)
Antibodies (5)
Jump to Filters
View as table Download
SF2 (SRSF1) (NM_006924) Human Tagged ORF Clone
RC201636

USD 98.00

USD 390.00

In Stock

SRSF1 (Myc-DDK-tagged)-Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SF2 (SRSF1) (NM_001078166) Human Tagged ORF Clone
RC213304

USD 98.00

USD 390.00

In Stock

SRSF1 (Myc-DDK-tagged)-Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
SF2 (SRSF1) (NM_006924) Human Recombinant Protein
TP301636

USD 823.00

In Stock

Recombinant protein of human splicing factor, arginine/serine-rich 1 (SFRS1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
SF2 (SRSF1) (NM_006924) Human Tagged ORF Clone Lentiviral Particle
RC201636L1V

USD 820.00

3 Weeks

Lenti ORF particles, SRSF1 (Myc-DDK tagged) - Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
SF2 (SRSF1) (NM_001078166) Human Tagged ORF Clone Lentiviral Particle
RC213304L2V

USD 820.00

6 Weeks

Lenti ORF particles, SRSF1 (mGFP-tagged) - Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
SF2 (SRSF1) (NM_006924) Human Tagged ORF Clone
RG201636

USD 460.00

In Stock

SRSF1 (GFP-tagged) - Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SF2 (SRSF1) (NM_006924) Human Tagged ORF Clone
RC201636L3

USD 620.00

In Stock

Lenti ORF clone of Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SF2 (SRSF1) (NM_006924) Human Tagged ORF Clone Lentiviral Particle
RC201636L3V

USD 820.00

3 Weeks

Lenti ORF particles, SRSF1 (Myc-DDK tagged) - Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SF2 (SRSF1) (NM_006924) Human Tagged ORF Clone
RC201636L4

USD 620.00

3 Weeks

Lenti ORF clone of Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SF2 (SRSF1) (NM_006924) Human Tagged ORF Clone Lentiviral Particle
RC201636L4V

USD 820.00

7 Weeks

Lenti ORF particles, SRSF1 (mGFP-tagged) - Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SF2 (SRSF1) (NM_001078166) Human Tagged ORF Clone
RC213304L3

USD 620.00

3 Weeks

Lenti ORF clone of Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SF2 (SRSF1) (NM_001078166) Human Tagged ORF Clone Lentiviral Particle
RC213304L3V

USD 820.00

5 Weeks

Lenti ORF particles, SRSF1 (Myc-DDK tagged) - Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
SF2 (SRSF1) (NM_001078166) Human Tagged ORF Clone
RC213304L4

USD 620.00

In Stock

Lenti ORF clone of Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SF2 (SRSF1) (NM_001078166) Human Tagged ORF Clone Lentiviral Particle
RC213304L4V

USD 820.00

3 Weeks

Lenti ORF particles, SRSF1 (mGFP-tagged) - Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
SF2 (SRSF1) (NM_001078166) Human Tagged ORF Clone
RG213304

USD 460.00

3 Weeks

SRSF1 (GFP-tagged) - Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
SF2 (SRSF1) (NM_006924) Human Untagged Clone
SC115786

USD 310.00

In Stock

SRSF1 (untagged)-Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SF2 (SRSF1) Rabbit Polyclonal Antibody
TA327123

USD 275.00

3 Weeks

Rabbit anti-SFRS1 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SFRS1
SF2 (SRSF1) (NM_006924) Human Tagged ORF Clone
RC201636L1

USD 620.00

In Stock

Lenti ORF clone of Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
SF2 (SRSF1) (NM_006924) Human Tagged ORF Clone Lentiviral Particle
RC201636L2V

USD 1,020.00

6 Weeks

Lenti ORF particles, SRSF1 (mGFP-tagged) - Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
SF2 (SRSF1) Rabbit Polyclonal Antibody
TA345990

USD 410.00

5 Days

Rabbit Polyclonal Anti-SFRS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SFRS1 antibody: synthetic peptide directed towards the middle region of human SFRS1. Synthetic peptide located within the following region: GVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRS
SF2 (SRSF1) (NM_006924) Human Untagged Clone
SC323930

USD 420.00

In Stock

SRSF1 (untagged)-Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
SF2 (SRSF1) Rabbit Polyclonal Antibody
TA345989

USD 475.00

5 Days

Rabbit Polyclonal Anti-SFRS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SFRS1 antibody: synthetic peptide directed towards the C terminal of human SFRS1. Synthetic peptide located within the following region: EFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSR
SF2 (SRSF1) (C-term) Rabbit Polyclonal Antibody
AP17742PU-N

USD 450.00

2 Weeks

SF2 (SRSF1) (C-term) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 165~194 amino acids from the C-terminal region of Human SFRS1
SF2 (SRSF1) (NM_001078166) Human Over-expression Lysate
LY421492

USD 396.00

In Stock

Transient overexpression lysate of splicing factor, arginine/serine-rich 1 (SFRS1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Special Offer: Get a 20% discount on this product. Use code: "OEL20".

LY421492 is the same product as LY425877.
SF2 (SRSF1) (NM_006924) Human Tagged ORF Clone
RC201636L2

USD 620.00

3 Weeks

Lenti ORF clone of Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
SF2 (SRSF1) (NM_001078166) Human Tagged ORF Clone
RC213304L2

USD 620.00

3 Weeks

Lenti ORF clone of Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
SF2 (SRSF1) Rabbit Polyclonal Antibody
TA590840

USD 409.00

In Stock

Rabbit Polyclonal SF2 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody was made against a protein fragment from the N Terminus Region
SF2 (SRSF1) (NM_006924) Human Over-expression Lysate
LC402060

USD 121.00

In Stock

SRSF1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
SF2 (SRSF1) (NM_001078166) Human Over-expression Lysate
LC421492

USD 121.00

In Stock

SRSF1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SF2 (SRSF1) (NM_001078166) Human Over-expression Lysate
LC425877

USD 121.00

In Stock

SRSF1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
SF2 (SRSF1) (NM_001078166) Human Recombinant Protein
TP761870

USD 215.00

In Stock

Purified recombinant protein of Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 2, full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug

Tag N-GST and C-His
Expression Host E. coli
SFRS1 (SF2) (1-248, His-tag) Human Protein
AR50773PU-N

USD 845.00

2 Weeks

SFRS1 (SF2) (1-248, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
SFRS1 (SF2) (1-248, His-tag) Human Protein
AR50773PU-S

USD 330.00

2 Weeks

SFRS1 (SF2) (1-248, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
SF2 (SRSF1) (NM_006924) Human Mass Spec Standard
PH301636

USD 2,055.00

3 Weeks

SFRS1 MS Standard C13 and N15-labeled recombinant protein (NP_008855)

Tag C-Myc/DDK
Expression Host HEK293
SF2 (SRSF1) (NM_001078166) Human Untagged Clone
SC315487

USD 420.00

3 Weeks

SRSF1 (untagged)-Human serine/arginine-rich splicing factor 1 (SRSF1), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
SF2 (SRSF1) ICC Control Block
TB401636

USD 1,040.00

4 Weeks

Transient overexpression of SRSF1 (NM_006924) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SF2 (SRSF1) ICC Control Block
TB413304

USD 1,040.00

4 Weeks

Transient overexpression of SRSF1 (NM_001078166) in HEK293T cells paraffin embedded controls for ICC/IHC staining

SF2 (SRSF1) Cytosection
TS401636

USD 225.00

4 Weeks

Transient overexpression of SRSF1 (NM_006924) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

SF2 (SRSF1) Cytosection
TS401636P5

USD 889.00

4 Weeks

Transient overexpression of SRSF1 (NM_006924) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

SF2 (SRSF1) Cytosection
TS413304

USD 225.00

4 Weeks

Transient overexpression of SRSF1 (NM_001078166) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

SF2 (SRSF1) Cytosection
TS413304P5

USD 889.00

4 Weeks

Transient overexpression of SRSF1 (NM_001078166) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack