Germany
Japan
United Kingdom
China
ABCD4 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family D (ALD), member 4 (ABCD4), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Abcd4 (Myc-DDK-tagged) - Mouse ATP-binding cassette, sub-family D (ALD), member 4 (cDNA clone MGC:60642 IMAGE:30012556)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human ATP-binding cassette, sub-family D (ALD), member 4 (ABCD4), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Abcd4 (Myc-DDK-tagged) - Mouse ATP-binding cassette, sub-family D (ALD), member 4 (Abcd4)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ABCD4 (GFP-tagged) - Human ATP-binding cassette, sub-family D (ALD), member 4 (ABCD4), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ABCD4 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN401291 is the updated version of KN201291.
Abcd4 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN500634 is the updated version of KN300634.
Abcd4 (GFP-tagged) - Mouse ATP-binding cassette, sub-family D (ALD), member 4 (cDNA clone MGC:60642 IMAGE:30012556)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Abcd4 (GFP-tagged) - Mouse ATP-binding cassette sub-family D (ALD) member 4 (Abcd4), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Abcd4 (Myc-DDK-tagged) - Mouse ATP-binding cassette, sub-family D (ALD), member 4 (cDNA clone MGC:60642 IMAGE:30012556)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Abcd4 (Myc-DDK-tagged) - Mouse ATP-binding cassette, sub-family D (ALD), member 4 (cDNA clone MGC:60642 IMAGE:30012556), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Abcd4 (mGFP-tagged) - Mouse ATP-binding cassette, sub-family D (ALD), member 4 (cDNA clone MGC:60642 IMAGE:30012556)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Abcd4 (GFP-tagged) - Mouse ATP-binding cassette, sub-family D (ALD), member 4 (cDNA clone MGC:60642 IMAGE:30012556), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Abcd4 (Myc-DDK-tagged) - Mouse ATP-binding cassette, sub-family D (ALD), member 4 (Abcd4)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Abcd4 (Myc-DDK-tagged) - Mouse ATP-binding cassette, sub-family D (ALD), member 4 (Abcd4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Abcd4 (mGFP-tagged) - Mouse ATP-binding cassette, sub-family D (ALD), member 4 (Abcd4)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Abcd4 (GFP-tagged) - Mouse ATP-binding cassette, sub-family D (ALD), member 4 (Abcd4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ATP-binding cassette, sub-family D (ALD), member 4 (ABCD4), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ABCD4 (Myc-DDK tagged) - Human ATP-binding cassette, sub-family D (ALD), member 4 (ABCD4), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ATP-binding cassette, sub-family D (ALD), member 4 (ABCD4), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ABCD4 (mGFP-tagged) - Human ATP-binding cassette, sub-family D (ALD), member 4 (ABCD4), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Abcd4 (Myc-DDK-tagged ORF) - Rat ATP-binding cassette, sub-family D (ALD), member 4 (Abcd4), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Abcd4 (Myc-DDK-tagged ORF) - Rat ATP-binding cassette, sub-family D (ALD), member 4 (Abcd4), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Abcd4 (Myc-DDK-tagged ORF) - Rat ATP-binding cassette, sub-family D (ALD), member 4 (Abcd4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Abcd4 (mGFP-tagged ORF) - Rat ATP-binding cassette, sub-family D (ALD), member 4 (Abcd4), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Abcd4 (GFP-tagged ORF) - Rat ATP-binding cassette, sub-family D (ALD), member 4 (Abcd4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ABCD4 (untagged)-Human ATP-binding cassette, sub-family D (ALD), member 4 (ABCD4), transcript variant 4
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Abcd4 (untagged) - Mouse ATP-binding cassette, sub-family D (ALD), member 4 (cDNA clone MGC:60642 IMAGE:30012556), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit polyclonal anti-ABCD4 antibody
| Applications | WB |
| Reactivities | Human Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABCD4. |
ABCD4 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
ABCD4 (untagged)-Human ATP-binding cassette, sub-family D (ALD), member 4 (ABCD4), transcript variant 3
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
ABCD4 (untagged)-Human ATP-binding cassette, sub-family D (ALD), member 4 (ABCD4), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit anti-ABCD4 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human ABCD4. |
Rabbit Polyclonal Anti-ABCD4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ABCD4 Antibody: synthetic peptide directed towards the N terminal of human ABCD4. Synthetic peptide located within the following region: YVSWRKDLTEHLHRLYFRGRAYYTLNVLRDDIDNPDQRISQDVERFCRQL |
Rabbit Polyclonal Anti-ABCD4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ABCD4 Antibody: synthetic peptide directed towards the C terminal of human ABCD4. Synthetic peptide located within the following region: FGPHGVLFLPQKPFFTDGTLREQVIYPLKEVYPDSGSADDERILRFLELA |
ABCD4 CRISPRa kit - CRISPR gene activation of human ATP binding cassette subfamily D member 4
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Abcd4 CRISPRa kit - CRISPR gene activation of mouse ATP-binding cassette, sub-family D (ALD), member 4
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene ABCD4
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene ABCD4
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Transient overexpression lysate of ATP-binding cassette, sub-family D (ALD), member 4 (ABCD4), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
qSTAR qPCR primer pairs against Mus musculus gene Abcd4
ABCD4 MS Standard C13 and N15-labeled recombinant protein (NP_005041)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Abcd4 (untagged ORF) - Rat ATP-binding cassette, sub-family D (ALD), member 4 (Abcd4), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of ATP-binding cassette sub-family D (ALD) member 4 (ABCD4) transcript variant 1 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
ABCD4 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SR321543 is the updated version of SR303926.
Abcd4 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
SR427067 is the updated version of SR416565.
Abcd4 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Anti-ABCD4 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 137-149 amino acids of human ATP-binding cassette, sub-family D (ALD), member 4 |
Anti-ABCD4 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 137-149 amino acids of human ATP-binding cassette, sub-family D (ALD), member 4 |
Active filters
Target Symbol
- ABCD4