DGKH (Myc-DDK-tagged)-Human diacylglycerol kinase, eta (DGKH), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
DGKH (Myc-DDK-tagged)-Human diacylglycerol kinase, eta (DGKH), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Dgkh (Myc-DDK-tagged) - Mouse diacylglycerol kinase, eta (Dgkh)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
DGKH - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Dgkh - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Dgkh (GFP-tagged) - Mouse diacylglycerol kinase eta (Dgkh), (10ug)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Dgkh (Myc-DDK-tagged) - Mouse diacylglycerol kinase, eta (Dgkh)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Dgkh (Myc-DDK-tagged) - Mouse diacylglycerol kinase, eta (Dgkh), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Dgkh (mGFP-tagged) - Mouse diacylglycerol kinase, eta (Dgkh)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Dgkh (GFP-tagged) - Mouse diacylglycerol kinase, eta (Dgkh), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Dgkh (myc-DDK-tagged) - Mouse diacylglycerol kinase, eta (Dgkh), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Dgkh (myc-DDK-tagged) - Mouse diacylglycerol kinase, eta (Dgkh), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
DGKH (Myc-DDK-tagged)-Human diacylglycerol kinase, eta (DGKH), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of DGKH (Myc-DDK-tagged)-Human diacylglycerol kinase, eta (DGKH), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, DGKH (Myc-DDK-tagged)-Human diacylglycerol kinase, eta (DGKH), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of DGKH (mGFP-tagged)-Human diacylglycerol kinase, eta (DGKH), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, DGKH (mGFP-tagged)-Human diacylglycerol kinase, eta (DGKH), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human diacylglycerol kinase, eta (DGKH), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, DGKH (Myc-DDK tagged) - Human diacylglycerol kinase, eta (DGKH), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human diacylglycerol kinase, eta (DGKH), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, DGKH (mGFP-tagged) - Human diacylglycerol kinase, eta (DGKH), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
DGKH (Myc-DDK tagged) - Homo sapiens diacylglycerol kinase, eta (DGKH), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
DGKH (Myc-DDK tagged) - Homo sapiens diacylglycerol kinase, eta (DGKH), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
DGKH (Myc-DDK tagged) - Homo sapiens diacylglycerol kinase, eta (DGKH), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
DGKH (myc-DDK-tagged) - Human diacylglycerol kinase, eta (DGKH), transcript variant 6
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
DGKH (GFP-tagged) - Human diacylglycerol kinase, eta (DGKH), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
DGKH (GFP-tagged) - Human diacylglycerol kinase, eta (DGKH), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
DGKH (GFP-tagged) - Homo sapiens diacylglycerol kinase, eta (DGKH), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
DGKH (GFP-tagged) - Homo sapiens diacylglycerol kinase, eta (DGKH), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
DGKH (GFP-tagged) - Homo sapiens diacylglycerol kinase, eta (DGKH), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit polyclonal anti-DGKH antibody
Applications | IF, IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DGKH. |
Dgkh (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Rabbit Polyclonal Anti-DGKH Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DGKH antibody: synthetic peptide directed towards the middle region of human DGKH. Synthetic peptide located within the following region: EPANQSSDYDSTETDESKEEAKDDGAKESITVKTAPRSPDARASYGHSQT |
Rabbit Polyclonal Anti-DGKH Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DGKH antibody: synthetic peptide directed towards the middle region of human DGKH. Synthetic peptide located within the following region: DLDSVDGYSEKCVMNNYFGIGLDAKISLEFNNKREEHPEKCRSRTKNLMW |
qSTAR qPCR primer pairs against Homo sapiens gene DGKH
DGKH CRISPRa kit - CRISPR gene activation of human diacylglycerol kinase eta
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Dgkh CRISPRa kit - CRISPR gene activation of mouse diacylglycerol kinase, eta
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
DGKH HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of diacylglycerol kinase, eta (DGKH), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Dgkh (untagged) - Mouse diacylglycerol kinase, eta (Dgkh), (10ug)
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Dgkh (untagged) - Mouse diacylglycerol kinase, eta (Dgkh), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Dgkh (untagged) - Mouse diacylglycerol kinase, eta (Dgkh), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Dgkh
DGKH MS Standard C13 and N15-labeled recombinant protein (NP_821077)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
DGKH (GFP-tagged) - Human diacylglycerol kinase, eta (DGKH), transcript variant 6
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
3`UTR clone of diacylglycerol kinase eta (DGKH) transcript variant 2 for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |
3`UTR clone of diacylglycerol kinase eta (DGKH) transcript variant 1 for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |
DGKH (untagged)-Human diacylglycerol kinase, eta (DGKH), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
DGKH (untagged)-Human diacylglycerol kinase, eta (DGKH), transcript variant 1
Vector | pCMV6 series |
Tag | Tag Free |
DGKH (untagged) - Homo sapiens diacylglycerol kinase, eta (DGKH), transcript variant 4
Vector | pCMV6 series |
Tag | Tag Free |
DGKH (untagged) - Homo sapiens diacylglycerol kinase, eta (DGKH), transcript variant 5
Vector | pCMV6 series |
Tag | Tag Free |