Products

View as table Download

DGKH (Myc-DDK-tagged)-Human diacylglycerol kinase, eta (DGKH), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Dgkh (Myc-DDK-tagged) - Mouse diacylglycerol kinase, eta (Dgkh)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

DGKH - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN416937 is the updated version of KN216937.

Dgkh - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN504532 is the updated version of KN304532.

Dgkh (GFP-tagged) - Mouse diacylglycerol kinase eta (Dgkh), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Dgkh (Myc-DDK-tagged) - Mouse diacylglycerol kinase, eta (Dgkh)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Dgkh (mGFP-tagged) - Mouse diacylglycerol kinase, eta (Dgkh)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Dgkh (myc-DDK-tagged) - Mouse diacylglycerol kinase, eta (Dgkh), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Dgkh (myc-DDK-tagged) - Mouse diacylglycerol kinase, eta (Dgkh), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

DGKH (Myc-DDK-tagged)-Human diacylglycerol kinase, eta (DGKH), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of DGKH (Myc-DDK-tagged)-Human diacylglycerol kinase, eta (DGKH), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, DGKH (Myc-DDK-tagged)-Human diacylglycerol kinase, eta (DGKH), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of DGKH (mGFP-tagged)-Human diacylglycerol kinase, eta (DGKH), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, DGKH (mGFP-tagged)-Human diacylglycerol kinase, eta (DGKH), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human diacylglycerol kinase, eta (DGKH), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, DGKH (Myc-DDK tagged) - Human diacylglycerol kinase, eta (DGKH), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human diacylglycerol kinase, eta (DGKH), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, DGKH (mGFP-tagged) - Human diacylglycerol kinase, eta (DGKH), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

DGKH (Myc-DDK tagged) - Homo sapiens diacylglycerol kinase, eta (DGKH), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

DGKH (Myc-DDK tagged) - Homo sapiens diacylglycerol kinase, eta (DGKH), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

DGKH (Myc-DDK tagged) - Homo sapiens diacylglycerol kinase, eta (DGKH), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

DGKH (myc-DDK-tagged) - Human diacylglycerol kinase, eta (DGKH), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

DGKH (GFP-tagged) - Human diacylglycerol kinase, eta (DGKH), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

DGKH (GFP-tagged) - Human diacylglycerol kinase, eta (DGKH), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

DGKH (GFP-tagged) - Homo sapiens diacylglycerol kinase, eta (DGKH), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

DGKH (GFP-tagged) - Homo sapiens diacylglycerol kinase, eta (DGKH), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

DGKH (GFP-tagged) - Homo sapiens diacylglycerol kinase, eta (DGKH), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit polyclonal anti-DGKH antibody

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DGKH.

Dgkh (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Rabbit Polyclonal Anti-DGKH Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DGKH antibody: synthetic peptide directed towards the middle region of human DGKH. Synthetic peptide located within the following region: EPANQSSDYDSTETDESKEEAKDDGAKESITVKTAPRSPDARASYGHSQT

Rabbit Polyclonal Anti-DGKH Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DGKH antibody: synthetic peptide directed towards the middle region of human DGKH. Synthetic peptide located within the following region: DLDSVDGYSEKCVMNNYFGIGLDAKISLEFNNKREEHPEKCRSRTKNLMW

qSTAR qPCR primer pairs against Homo sapiens gene DGKH

DGKH CRISPRa kit - CRISPR gene activation of human diacylglycerol kinase eta

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

Dgkh CRISPRa kit - CRISPR gene activation of mouse diacylglycerol kinase, eta

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

DGKH HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Dgkh (untagged) - Mouse diacylglycerol kinase, eta (Dgkh), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Dgkh (untagged) - Mouse diacylglycerol kinase, eta (Dgkh), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Dgkh (untagged) - Mouse diacylglycerol kinase, eta (Dgkh), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

qSTAR qPCR primer pairs against Mus musculus gene Dgkh

DGKH MS Standard C13 and N15-labeled recombinant protein (NP_821077)

Tag C-Myc/DDK
Expression Host HEK293

DGKH (GFP-tagged) - Human diacylglycerol kinase, eta (DGKH), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

3`UTR clone of diacylglycerol kinase eta (DGKH) transcript variant 2 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase

3`UTR clone of diacylglycerol kinase eta (DGKH) transcript variant 1 for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase

DGKH (untagged)-Human diacylglycerol kinase, eta (DGKH), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

DGKH (untagged)-Human diacylglycerol kinase, eta (DGKH), transcript variant 1

Vector pCMV6 series
Tag Tag Free

DGKH (untagged) - Homo sapiens diacylglycerol kinase, eta (DGKH), transcript variant 4

Vector pCMV6 series
Tag Tag Free

DGKH (untagged) - Homo sapiens diacylglycerol kinase, eta (DGKH), transcript variant 5

Vector pCMV6 series
Tag Tag Free