Germany
Japan
United Kingdom
China
GNLY (Myc-DDK-tagged)-Human granulysin (GNLY), transcript variant NKG5
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human granulysin (GNLY), transcript variant NKG5
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF particles, GNLY (Myc-DDK tagged) - Human granulysin (GNLY), transcript variant NKG5, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, GNLY (mGFP-tagged) - Human granulysin (GNLY), transcript variant NKG5, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
GNLY (GFP-tagged) - Human granulysin (GNLY), transcript variant NKG5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GNLY - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN404321 is the updated version of KN204321.
Lenti ORF clone of Human granulysin (GNLY), transcript variant NKG5, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GNLY (Myc-DDK tagged) - Human granulysin (GNLY), transcript variant NKG5, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human granulysin (GNLY), transcript variant NKG5, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GNLY (mGFP-tagged) - Human granulysin (GNLY), transcript variant NKG5, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GNLY (Myc-DDK-tagged)-Human granulysin (GNLY), transcript variant 519
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of GNLY (Myc-DDK-tagged)-Human granulysin (GNLY), transcript variant 519
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GNLY (Myc-DDK-tagged)-Human granulysin (GNLY), transcript variant 519, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of GNLY (mGFP-tagged)-Human granulysin (GNLY), transcript variant 519
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GNLY (mGFP-tagged)-Human granulysin (GNLY), transcript variant 519, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GNLY (myc-DDK-tagged) - Human granulysin (GNLY), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GNLY (GFP-tagged) - Human granulysin (GNLY), transcript variant 519
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human granulysin (GNLY), transcript variant NKG5, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
GNLY (untagged)-Human granulysin (GNLY), transcript variant NKG5
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-GNLY Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GNLY antibody: synthetic peptide directed towards the n terminal of human GNLY. Synthetic peptide located within the following region: TRVCRTGRSRWRDVCRNFMRRYQSRVIQGLVAGETAQQICEDLRLCIPSTG |
Lenti ORF clone of Human granulysin (GNLY), transcript variant NKG5, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
GNLY mouse monoclonal antibody, clone B-L38, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
GNLY mouse monoclonal antibody, clone B-R32, Azide Free
| Reactivities | Human |
Transient overexpression lysate of granulysin (GNLY), transcript variant NKG5
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
GNLY mouse monoclonal antibody, clone B-L38, Azide Free
| Reactivities | Human |
GNLY mouse monoclonal antibody, clone B-L38, Purified
| Applications | FC |
| Reactivities | Human |
GNLY (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 13-43 amino acids from the N-terminal region of Human GNLY |
Human Granulysin ELISA Kit
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Human Granulysin |
| Reactivities | Human |
The Fast version of Picokine ELISA kits, assay takes less than 1.5 hours. Detect Human Granulysin/GNLY with <10pg/ml sensitivity. Format: 96-well plate with removable strips. Compatible samples: cell culture supernates, cell lysates, serum and plasma (heparin, EDTA). This is a TMB colorimetric sandwich ELISA kit with short assay time and fast experiment set up. Granulysin/GNLY tissue specificity: Expressed in natural killer and T-cells.
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Human Granulysin |
| Format | 8x12 divisible strips |
| Reactivities | Human |
GNLY CRISPRa kit - CRISPR gene activation of human granulysin
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene GNLY
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene GNLY
GNLY HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
GNLY MS Standard C13 and N15-labeled recombinant protein (NP_006424)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
AAV ORF Particles, serotype AAV-2, GNLY (Myc-DDK-tagged)-Human granulysin (GNLY), transcript variant NKG5, 250ul, >10^13 TU/mL
- AAV ORF®
-
GNLY (GFP-tagged) - Human granulysin (GNLY), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
3`UTR clone of granulysin (GNLY) transcript variant NKG5 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of granulysin (GNLY) transcript variant 519 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
GNLY (untagged) - Human granulysin (GNLY), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
GNLY (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Transient overexpression of GNLY (NM_006433) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GNLY (NM_012483) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GNLY (NM_001302758) in HEK293T cells paraffin embedded controls for ICC/IHC staining
GNLY - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
GNLY - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
GNLY - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Transient overexpression of GNLY (NM_006433) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Active filters
Target Symbol
- GNLY