Germany
Japan
United Kingdom
China
P4HB (Myc-DDK-tagged)-Human prolyl 4-hydroxylase, beta polypeptide (P4HB)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
P4HB (untagged)-Human prolyl 4-hydroxylase, beta polypeptide (P4HB)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Recombinant protein of human prolyl 4-hydroxylase, beta polypeptide (P4HB)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
P4hb (Myc-DDK-tagged) - Mouse prolyl 4-hydroxylase, beta polypeptide (P4hb)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, P4HB (Myc-DDK tagged) - Human prolyl 4-hydroxylase, beta polypeptide (P4HB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, P4HB (mGFP-tagged) - Human prolyl 4-hydroxylase, beta polypeptide (P4HB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
P4HB (GFP-tagged) - Human prolyl 4-hydroxylase, beta polypeptide (P4HB)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
P4hb (Myc-DDK-tagged ORF) - Rat prolyl 4-hydroxylase, beta polypeptide (P4hb), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
P4HB - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN402275 is the updated version of KN202275.
P4hb - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN512726 is the updated version of KN312726.
P4hb (GFP-tagged) - Mouse prolyl 4-hydroxylase, beta polypeptide (P4hb)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of P4hb (Myc-DDK-tagged) - Mouse prolyl 4-hydroxylase, beta polypeptide (P4hb)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, P4hb (Myc-DDK-tagged) - Mouse prolyl 4-hydroxylase, beta polypeptide (P4hb), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of P4hb (mGFP-tagged) - Mouse prolyl 4-hydroxylase, beta polypeptide (P4hb)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, P4hb (GFP-tagged) - Mouse prolyl 4-hydroxylase, beta polypeptide (P4hb), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, P4HB (Myc-DDK tagged) - Human prolyl 4-hydroxylase, beta polypeptide (P4HB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, P4HB (mGFP-tagged) - Human prolyl 4-hydroxylase, beta polypeptide (P4HB), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of P4hb (Myc-DDK-tagged ORF) - Rat prolyl 4-hydroxylase, beta polypeptide (P4hb), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, P4hb (Myc-DDK-tagged ORF) - Rat prolyl 4-hydroxylase, beta polypeptide (P4hb), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of P4hb (mGFP-tagged ORF) - Rat prolyl 4-hydroxylase, beta polypeptide (P4hb), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, P4hb (GFP-tagged ORF) - Rat prolyl 4-hydroxylase, beta polypeptide (P4hb), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
P4HB - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human prolyl 4-hydroxylase, beta polypeptide (P4HB), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal antibody to PDI (prolyl 4-hydroxylase, beta polypeptide)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 23 and 227 of PDI (Uniprot ID#P07237) |
Lenti ORF clone of Human prolyl 4-hydroxylase, beta polypeptide (P4HB), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
P4hb (untagged) - Mouse prolyl 4-hydroxylase, beta polypeptide (P4hb), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human prolyl 4-hydroxylase, beta polypeptide (P4HB), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Rabbit Polyclonal Anti-P4HB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P4HB antibody: synthetic peptide directed towards the N terminal of human P4HB. Synthetic peptide located within the following region: TIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLV |
P4hb (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
P4hb (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
P4HB (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SR321210 is the updated version of SR303332.
Rabbit anti-P4HB Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human P4HB |
Prolyl 4-Hydroxylase beta (protein disulfide isomerase, fibroblasts), mouse anti rat, clone 6-9H6
| Applications | ELISA, IHC |
| Reactivities | Rat |
| Conjugation | Unconjugated |
qSTAR qPCR primer pairs against Homo sapiens gene P4HB
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Transient overexpression lysate of prolyl 4-hydroxylase, beta polypeptide (P4HB)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Anti-P4HB Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-P4HB antibody: synthetic peptide directed towards the C terminal of human P4HB. Synthetic peptide located within the following region: DRTVIDYNGERTLDGFKKFLESGGQDGAGDDDDLEDLEEAEEPDMEEDDD |
Lenti ORF clone of Human prolyl 4-hydroxylase, beta polypeptide (P4HB), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
P4hb - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
P4HB - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | GFP-puro |
P4HB HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
P4HB (untagged)-Human prolyl 4-hydroxylase, beta polypeptide (P4HB)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Purified recombinant protein of Human prolyl 4-hydroxylase, beta polypeptide (P4HB)
| Tag | C-His |
| Expression Host | E. coli |
Anti-P4HB Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 180 amino acids of human prolyl 4-hydroxylase, beta polypeptide |
P4hb - Rat, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
PDI / P4HB (18-508, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
PDI / P4HB (18-508, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
PDI / P4HB (20-509, His-tag) mouse protein, 0.25 mg
| Tag | His-tag |
| Expression Host | Insect |
PDI / P4HB (20-509, His-tag) mouse protein, 50 µg
| Tag | His-tag |
| Expression Host | Insect |
Active filters
Target Symbol
- P4HB