Germany
Japan
United Kingdom
China
PKMYT1 (Myc-DDK-tagged)-Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, PKMYT1 (Myc-DDK tagged) - Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, PKMYT1 (mGFP-tagged) - Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Pkmyt1 (Myc-DDK-tagged) - Mouse protein kinase, membrane associated tyrosine/threonine 1 (Pkmyt1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PKMYT1 (Myc-DDK-tagged)-Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PKMYT1 (GFP-tagged) - Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PKMYT1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN415116 is the updated version of KN215116.
Pkmyt1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN513365 is the updated version of KN313365.
Pkmyt1 (GFP-tagged) - Mouse protein kinase, membrane associated tyrosine/threonine 1 (Pkmyt1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Pkmyt1 (Myc-DDK-tagged) - Mouse protein kinase, membrane associated tyrosine/threonine 1 (Pkmyt1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pkmyt1 (Myc-DDK-tagged) - Mouse protein kinase, membrane associated tyrosine/threonine 1 (Pkmyt1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Pkmyt1 (mGFP-tagged) - Mouse protein kinase, membrane associated tyrosine/threonine 1 (Pkmyt1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pkmyt1 (GFP-tagged) - Mouse protein kinase, membrane associated tyrosine/threonine 1 (Pkmyt1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of PKMYT1 (Myc-DDK-tagged)-Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PKMYT1 (Myc-DDK-tagged)-Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of PKMYT1 (mGFP-tagged)-Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PKMYT1 (mGFP-tagged)-Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PKMYT1 (Myc-DDK tagged) - Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PKMYT1 (mGFP-tagged) - Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PKMYT1 (Myc-DDK tagged) - Homo sapiens protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PKMYT1 (Myc-DDK tagged) - Homo sapiens protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PKMYT1 (GFP-tagged) - Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PKMYT1 (GFP-tagged) - Homo sapiens protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PKMYT1 (GFP-tagged) - Homo sapiens protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Pkmyt1 (Myc-DDK-tagged ORF) - Rat protein kinase, membrane associated tyrosine/threonine 1 (Pkmyt1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Pkmyt1 (Myc-DDK-tagged ORF) - Rat protein kinase, membrane associated tyrosine/threonine 1 (Pkmyt1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pkmyt1 (Myc-DDK-tagged ORF) - Rat protein kinase, membrane associated tyrosine/threonine 1 (Pkmyt1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Pkmyt1 (mGFP-tagged ORF) - Rat protein kinase, membrane associated tyrosine/threonine 1 (Pkmyt1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Pkmyt1 (GFP-tagged ORF) - Rat protein kinase, membrane associated tyrosine/threonine 1 (Pkmyt1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
PKMYT1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
PKMYT1 (untagged)-Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Transient overexpression of PKMYT1 (NM_182687) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
PKMYT1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Transient overexpression lysate of protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
PKMYT1 (untagged)-Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
PKMYT1 (untagged)-Kinase deficient mutant (K139M) of Human protein kinase, membrane associated tyrosine/threonine 1 (PKMYT1), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Pkmyt1 (untagged) - Mouse protein kinase, membrane associated tyrosine/threonine 1 (Pkmyt1), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PKMYT1 - Human, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
Rabbit polyclonal MYT1 (Ser83) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MYT1 around the phosphorylation site of serine 83 (R-V-SP-F-R). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-Myt1 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Myt1 antibody: synthetic peptide directed towards the n terminal of mouse Myt1. Synthetic peptide located within the following region: VSKRKSHPLRLALDEGYRMDSDGSEDAEVKDVSVSDESEGPLEEAEAEMS |
PKMYT1 CRISPRa kit - CRISPR gene activation of human protein kinase, membrane associated tyrosine/threonine 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene PKMYT1
| Application | Plasmid of exact quantity for transcript copy number calculation |
Active filters
Target Symbol
- PKMYT1