vif (NC_001802) Virus Tagged ORF Clone
CAT#: VC101719
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for Vif [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057851
"NC_001802" in other vectors (19)
Product Images
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | vif |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC101719 represents NCBI reference of NP_057851 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGAGAACAGGTGGCAAGTGATGATTGTCTGGCAAGTGGACCGCATGCGAATTAGGACGTGGAAGAGCT TGGTGAAACACCATATGTACGTAAGTGGCAAGGCTCGGGGATGGTTCTACAGACATCACTACGAATCTCC ACACCCTCGAATTTCTTCCGAGGTACATATCCCGCTCGGGGATGCGCGATTGGTCATTACGACCTACTGG GGCCTCCATACCGGCGAGCGGGACTGGCACCTGGGCCAGGGCGTTTCTATTGAGTGGCGAAAAAAGCGGT ACTCTACTCAGGTAGACCCCGAACTGGCAGACCAGCTGATACATCTGTATTATTTTGATTGCTTTAGTGA CTCCGCGATCCGGAAGGCCCTCCTTGGCCATATCGTCTCCCCCAGGTGCGAGTACCAGGCCGGCCATAAT AAAGTGGGTAGTCTGCAGTATCTGGCTTTGGCCGCACTGATTACTCCCAAGAAGATTAAACCCCCTCTCC CATCAGTAACTAAGCTTACGGAAGACAGATGGAACAAACCCCAAAAGACAAAAGGACATCGCGGGAGTCA TACAATGAATGGACAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC101719 representing NP_057851
Red=Cloning sites Green=Tags MENRWQVMIVWQVDRMRIRTWKSLVKHHMYVSGKARGWFYRHHYESPHPRISSEVHIPLGDARLVITTYW GLHTGERDWHLGQGVSIEWRKKRYSTQVDPELADQLIHLYYFDCFSDSAIRKALLGHIVSPRCEYQAGHN KVGSLQYLALAALITPKKIKPPLPSVTKLTEDRWNKPQKTKGHRGSHTMNGH TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_001802 |
ORF Size | 576 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decuded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Reference Data | |
RefSeq | NC_001802.1, NP_057851 |
RefSeq ORF | 576 |
Locus ID | 155459 |
MW | 22.5 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC101716 | Myc-DDK-tagged ORF clone of viral ORF for Tat [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057853 |
USD 400.00 |
|
VC101717 | Myc-DDK-tagged ORF clone of viral ORF for Rev [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057854 |
USD 400.00 |
|
VC101718 | Myc-DDK-tagged ORF clone of viral ORF for Pr55(Gag) [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057850 |
USD 640.00 |
|
VC101720 | Myc-DDK-tagged ORF clone of viral ORF for Vpr [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057852 |
USD 400.00 |
|
VC101721 | Myc-DDK-tagged ORF clone of viral ORF for Envelope surface glycoprotein gp160, precursor [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057856 |
USD 1,360.00 |
|
VC101722 | Myc-DDK-tagged ORF clone of viral ORF for Nef [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057857 |
USD 400.00 |
|
VC101723 | Myc-DDK-tagged ORF clone of viral ORF for Vpu [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_057855 |
USD 400.00 |
|
VC101724 | Myc-DDK-tagged ORF clone of viral ORF for matrix [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579876 |
USD 400.00 |
|
VC101725 | Myc-DDK-tagged ORF clone of viral ORF for capsid [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579880 |
USD 400.00 |
|
VC101726 | Myc-DDK-tagged ORF clone of viral ORF for nucleocapsid [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579881 |
USD 400.00 |
|
VC101727 | Myc-DDK-tagged ORF clone of viral ORF for p2 [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579882 |
USD 400.00 |
|
VC101728 | Myc-DDK-tagged ORF clone of viral ORF for p6 [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579883 |
USD 400.00 |
|
VC101729 | Myc-DDK-tagged ORF clone of viral ORF for unnamed protein product [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579893 |
USD 400.00 |
|
VC101730 | Myc-DDK-tagged ORF clone of viral ORF for Envelope transmembrane glycoprotein gp41 [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579895 |
USD 430.00 |
|
VC101732 | Myc-DDK-tagged ORF clone of viral ORF for retropepsin [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_705926 |
USD 400.00 |
|
VC101735 | Myc-DDK-tagged ORF clone of viral ORF for p1 [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_787042 |
USD 400.00 |
|
VC101736 | Myc-DDK-tagged ORF clone of viral ORF for Gag-Pol Transframe peptide [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_787043 |
USD 400.00 |
|
VC101737 | Myc-DDK-tagged ORF clone of viral ORF for reverse transcriptase p51 subunit [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_789739 |
USD 570.00 |
|
VC101739 | Myc-DDK-tagged ORF clone of viral ORF for Envelope surface glycoprotein gp120 [Human immunodeficiency virus 1], codon optimized for human cell expression, NP_579894 |
USD 620.00 |
{0} Product Review(s)
Be the first one to submit a review