Antibodies for $/€ 289

View as table Download

Rabbit Polyclonal Anti-DLD Antibody - middle region

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-DLD antibody: synthetic peptide directed towards the middle region of human DLD. Synthetic peptide located within the following region: AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF

Rabbit Polyclonal Anti-ACO1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ACO1 antibody: synthetic peptide directed towards the N terminal of human ACO1. Synthetic peptide located within the following region: MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNC

Rabbit Polyclonal Anti-ATP6V0A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ATP6V0A2 antibody: synthetic peptide directed towards the N terminal of human ATP6V0A2. Synthetic peptide located within the following region: INRADIPLPEGEASPPAPPLKQVLEMQEQLQKLEVELREVTKNKEKLRKN

Rabbit Polyclonal Anti-UMPS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UMPS antibody: synthetic peptide directed towards the C terminal of human UMPS. Synthetic peptide located within the following region: VGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDII

Rabbit Polyclonal Anti-BHMT Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-BHMT antibody: synthetic peptide directed towards the N terminal of human BHMT. Synthetic peptide located within the following region: AVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQE

Rabbit Polyclonal Anti-LDHB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-LDHB antibody is: synthetic peptide directed towards the C-terminal region of Human LDHB. Synthetic peptide located within the following region: MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD

Rabbit Polyclonal Anti-TSTA3 Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TSTA3 antibody: synthetic peptide directed towards the N terminal of human TSTA3. Synthetic peptide located within the following region: MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTD

Rabbit Polyclonal Anti-BHMT Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-BHMT antibody: synthetic peptide directed towards the C terminal of human BHMT. Synthetic peptide located within the following region: KHGSWGSGLDMHTKPWVRARARKEYWENLRIASGRPYNPSMSKPDGWGVT

Rabbit Polyclonal Anti-SQLE Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SQLE antibody: synthetic peptide directed towards the C terminal of human SQLE. Synthetic peptide located within the following region: KKSFYWARKTSHSFVVNILAQALYELFSATDDSLHQLRKACFLYFKLGGE

Rabbit Polyclonal Anti-GOT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GOT1 antibody: synthetic peptide directed towards the N terminal of human GOT1. Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV

Rabbit Polyclonal Anti-PGLS Antibody - middle region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PGLS antibody: synthetic peptide directed towards the middle region of human PGLS. Synthetic peptide located within the following region: AAVLKRILEDQEENPLPAALVQPHTGKLCWFLDEAAARLLTVPFEKHSTL

Rabbit Polyclonal Anti-DDC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDC antibody: synthetic peptide directed towards the N terminal of human DDC. Synthetic peptide located within the following region: EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFE

Rabbit Polyclonal Anti-DLAT Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DLAT antibody: synthetic peptide directed towards the N terminal of human DLAT. Synthetic peptide located within the following region: WTPSSGATPRNRLLLQLLGSPGRRYYSLPPHQKVPLPSLSPTMQAGTIAR

Rabbit Polyclonal Anti-OAT Antibody

Applications IHC, WB
Reactivities Human, Pig
Conjugation Unconjugated
Immunogen The immunogen for anti-OAT antibody: synthetic peptide directed towards the C terminal of human OAT. Synthetic peptide located within the following region: VRGKGLLNAIVIKETKDWDAWKVCLRLRDNGLLAKPTHGDIIRFAPPLVI

Rabbit Polyclonal Anti-ACAA1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ACAA1 antibody: synthetic peptide directed towards the N terminal of human ACAA1. Synthetic peptide located within the following region: ADVVVVHGRRTAICRAGRGGFKDTTPDELLSAVMTAVLKDVNLRPEQLGD

Rabbit Polyclonal Anti-PGS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PGS1 antibody: synthetic peptide directed towards the C terminal of human PGS1. Synthetic peptide located within the following region: QIAIVTENQALQQQLHQEQEQLYLRSGVVSSATFEQPSRQVKLWVKMVTP

Rabbit Polyclonal Anti-DCXR Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCXR antibody: synthetic peptide directed towards the middle region of human DCXR. Synthetic peptide located within the following region: STKGALDMLTKVMALELGPHKIRVNAVNPTVVMTSMGQATWSDPHKAKTM

Rabbit Polyclonal Anti-RPE Antibody - N-terminal region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPE antibody: synthetic peptide directed towards the N terminal of human RPE. Synthetic peptide located within the following region: ALIKDIRENGMKSCSVTQAEVQWHSQGPLQVGLAIKPGTSVEYLAPWANQ

Rabbit Polyclonal Anti-RPE Antibody - middle region

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPE antibody: synthetic peptide directed towards the middle region of human RPE. Synthetic peptide located within the following region: MMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK

Rabbit Polyclonal Anti-AUH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AUH antibody: synthetic peptide directed towards the C terminal of human AUH. Synthetic peptide located within the following region: IGMSLAKELIFSARVLDGKEAKAVGLISHVLEQNQEGDAAYRKALDLARE

Rabbit Polyclonal Anti-ASS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASS antibody: synthetic peptide directed towards the N terminal of human ASS. Synthetic peptide located within the following region: YSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVF

Rabbit Polyclonal Anti-KHK Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KHK antibody: synthetic peptide directed towards the C terminal of human KHK. Synthetic peptide located within the following region: FQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRV

Rabbit Polyclonal Anti-MAT1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAT1A antibody: synthetic peptide directed towards the N terminal of human MAT1A. Synthetic peptide located within the following region: TSESVGEGHPDKICDQISDAVLDAHLKQDPNAKVACETVCKTGMVLLCGE

Rabbit Polyclonal Anti-PRPS2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRPS2 antibody: synthetic peptide directed towards the middle region of human PRPS2. Synthetic peptide located within the following region: VSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAI

Rabbit Polyclonal Anti-CKMT2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CKMT2 antibody: synthetic peptide directed towards the N terminal of human CKMT2. Synthetic peptide located within the following region: GTSVLTTGYLLNRQKVCAEVREQPRLFPPSADYPDLRKHNNCMAECLTPA

Rabbit Polyclonal Anti-PRODH2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRODH2 antibody: synthetic peptide directed towards the C terminal of human PRODH2. Synthetic peptide located within the following region: LGIPLDGTVCFGQLLGMCDHVSLALGQAGYVVYKSIPYGSLEEVIPYLIR

Rabbit Polyclonal Anti-HSD17B1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HSD17B1 antibody: synthetic peptide directed towards the N terminal of human HSD17B1. Synthetic peptide located within the following region: MARTVVLITGCSSGIGLHLAVRLASDPSQSFKVYATLRDLKTQGRLWEAA

Rabbit Polyclonal Anti-ADH1B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADH1B antibody: synthetic peptide directed towards the C terminal of human ADH1B. Synthetic peptide located within the following region: NLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHV

Rabbit Polyclonal Anti-CYP4F3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP4F3 antibody: synthetic peptide directed towards the N terminal of human CYP4F3. Synthetic peptide located within the following region: LAWTYTFYDNCCRLRCFPQPPKRNWFLGHLGLIHSSEEGLLYTQSLACTF

Rabbit Polyclonal Anti-PON3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PON3 antibody: synthetic peptide directed towards the middle region of human PON3. Synthetic peptide located within the following region: PMKLLNYNPEDPPGSEVLRIQNVLSEKPRVSTVYANNGSVLQGTSVASVY

Rabbit Polyclonal Anti-CYP4A22 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYP4A22 antibody: synthetic peptide directed towards the N terminal of human CYP4A22. Synthetic peptide located within the following region: MSVSVLSPSRRLGGVSGILQVTSLLILLLLLIKAAQLYLHRQWLLKALQQ

Rabbit Polyclonal Anti-ALAS2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALAS2 antibody: synthetic peptide directed towards the N terminal of human ALAS2. Synthetic peptide located within the following region: VFKTVNRWADAYPFAQHFSEASVASKDVSVWCSNDYLGMSRHPQVLQATQ

Rabbit Polyclonal Anti-PPAP2A Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the middle region of human PPAP2A. Synthetic peptide located within the following region: DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL

Rabbit Polyclonal Anti-SARDH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SARDH antibody: synthetic peptide directed towards the middle region of human SARDH. Synthetic peptide located within the following region: DHPRWIRERSHESYAKNYSVVFPHDEPLAGRNMRRDPLHEELLGQGCVFQ

Rabbit Polyclonal Anti-PGK1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PGK1 antibody: synthetic peptide directed towards the C terminal of human PGK1. Synthetic peptide located within the following region: ATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFAR

Rabbit Polyclonal Anti-PTGDS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTGDS antibody: synthetic peptide directed towards the N terminal of human PTGDS. Synthetic peptide located within the following region: MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLAS

Rabbit Polyclonal Anti-ENO3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ENO3 antibody: synthetic peptide directed towards the N terminal of human ENO3. Synthetic peptide located within the following region: MAMQKIFAREILDSRGNPTVEVDLHTAKGRFRAAVPSGASTGIYEALELR

Rabbit Polyclonal Anti-PRDX6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRDX6 antibody: synthetic peptide directed towards the C terminal of human PRDX6. Synthetic peptide located within the following region: VATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP

Rabbit Polyclonal Anti-GRHPR Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GRHPR antibody: synthetic peptide directed towards the N terminal of human GRHPR. Synthetic peptide located within the following region: EPIPAKELERGVAGAHGLLCLLSDHVDKRILDAAGANLKVISTMSVGIDH

Rabbit Polyclonal Anti-GGPS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GGPS1 antibody: synthetic peptide directed towards the middle region of human GGPS1. Synthetic peptide located within the following region: LGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSRPESTQ

Rabbit Polyclonal Anti-HMGCS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMGCS1 antibody: synthetic peptide directed towards the middle region of human HMGCS1. Synthetic peptide located within the following region: KDFTLNDFGFMIFHSPYCKLVQKSLARMLLNDFLNDQNRDKNSIYSGLEA

Rabbit Polyclonal Anti-PGDS Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PGDS antibody: synthetic peptide directed towards the N terminal of human PGDS. Synthetic peptide located within the following region: EQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEME

Rabbit Polyclonal Anti-GMPPB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GMPPB antibody: synthetic peptide directed towards the C terminal of human GMPPB. Synthetic peptide located within the following region: RCRVGQWVRMENVTVLGEDVIVNDELYLNGASVLPHKSIGESVPEPRIIM