Rabbit Polyclonal Anti-CTAGE5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CTAGE5 antibody: synthetic peptide directed towards the middle region of human CTAGE5. Synthetic peptide located within the following region: LLEGPLRLSPLLPGGGGRGSRGPGNPLDHQITNERGESSCDRLTDPHRAP |
Rabbit Polyclonal Anti-CYP1A1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP1A1 antibody: synthetic peptide directed towards the middle region of human CYP1A1. Synthetic peptide located within the following region: QLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTV |
Rabbit Polyclonal Anti-CLDN18 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CLDN18 antibody: synthetic peptide directed towards the C terminal of human CLDN18. Synthetic peptide located within the following region: PEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDE |
Rabbit Polyclonal Anti-ANK1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANK1 antibody: synthetic peptide directed towards the middle region of human ANK1. Synthetic peptide located within the following region: PCAMPETVVIRSEEQEQASKEYDEDSLIPSSPATETSDNISPVASPVHTG |
Rabbit Polyclonal Anti-ABCB4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABCB4 antibody: synthetic peptide directed towards the middle region of human ABCB4. Synthetic peptide located within the following region: GRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSV |
Rabbit Polyclonal Anti-TSHR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSHR antibody: synthetic peptide directed towards the N terminal of human TSHR. Synthetic peptide located within the following region: CHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSHAFSNLPNISR |
Rabbit Polyclonal Anti-SIGLEC6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIGLEC6 antibody: synthetic peptide directed towards the N terminal of human SIGLEC6. Synthetic peptide located within the following region: VPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRL |
Rabbit Polyclonal Anti-NTSR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NTSR1 antibody: synthetic peptide directed towards the N terminal of human NTSR1. Synthetic peptide located within the following region: FGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVT |
Rabbit Polyclonal Anti-PIGZ Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIGZ antibody: synthetic peptide directed towards the N terminal of human PIGZ. Synthetic peptide located within the following region: VLWGGLSLLRVLWCLLPQTGYVHPDEFFQSPEVMAEDILGVQAARPWEFY |
Rabbit Polyclonal Anti-MFRP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MFRP antibody: synthetic peptide directed towards the middle region of human MFRP. Synthetic peptide located within the following region: HAIQLKIEALSIESVASCLFDRLELSPEPEGPLLRVCGRVPPPTLNTNAS |
Rabbit Polyclonal Anti-INSIG2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-INSIG2 antibody: synthetic peptide directed towards the N terminal of human INSIG2. Synthetic peptide located within the following region: MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQ |
Rabbit Polyclonal Anti-SLC13A3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC13A3 antibody: synthetic peptide directed towards the N terminal of human SLC13A3. Synthetic peptide located within the following region: MAVYWCTEALPLSVTALLPIVLFPFMGILPSNKVCPQYFLDTNFLFLSGL |
Rabbit Polyclonal Anti-SLC20A2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC20A2 antibody: synthetic peptide directed towards the N terminal of human SLC20A2. Synthetic peptide located within the following region: DVNLYNETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVGSTIGF |
Rabbit Polyclonal Anti-GALNT9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-GALNT9 antibody is: synthetic peptide directed towards the C-terminal region of Human GALNT9. Synthetic peptide located within the following region: DFGDVSERLALRQRLKCRSFKWYLENVYPEMRVYNNTLTYGEVRNSKASA |
Rabbit Polyclonal Anti-TMEM63B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMEM63B antibody: synthetic peptide directed towards the middle region of human TMEM63B. Synthetic peptide located within the following region: VRGCEQVEAIEYYTKLEQKLKEDYKREKEKVNEKPLGMAFVTFHNETITA |
Rabbit Polyclonal Anti-FAM121B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAM121B antibody: synthetic peptide directed towards the N terminal of human FAM121B. Synthetic peptide located within the following region: PASLSLLTFKVYAAPKKDSPPKNSVKVDELSLYSVPEGQSKYVEEARSQL |
Rabbit Polyclonal Anti-TMED4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMED4 antibody: synthetic peptide directed towards the middle region of human TMED4. Synthetic peptide located within the following region: DIQVGEHANNYPEIAAKDKLTELQLRARQLLDQVEQIQKEQDYQRYREER |
Rabbit Polyclonal Anti-FZD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD2 antibody: synthetic peptide directed towards the N terminal of human FZD2. Synthetic peptide located within the following region: MRPRSALPRLLLPLLLLPAAGPAQFHGEKGISIPDHGFCQPISIPLCTDI |
Rabbit Polyclonal Anti-WNT9B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT9B antibody: synthetic peptide directed towards the middle region of human WNT9B. Synthetic peptide located within the following region: CTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGSKRGNKDLRARADA |
Rabbit Polyclonal Anti-FZD5 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD5 antibody: synthetic peptide directed towards the middle region of human FZD5. Synthetic peptide located within the following region: CYLYEQHYRESWEAALTCACPGHDTGQPRAKPEYWVLMLKYFMCLVVGIT |
Rabbit Polyclonal Anti-FZD5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD5 antibody: synthetic peptide directed towards the C terminal of human FZD5. Synthetic peptide located within the following region: SRCCCRPRRGHKSGGAMAAGDYPEASAALTGRTGPPGPAATYHKQVSLSH |
Rabbit Polyclonal Anti-FZD6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD6 antibody: synthetic peptide directed towards the middle region of human FZD6. Synthetic peptide located within the following region: HKKKHYKPSSHKLKVISKSMGTSTGATANHGTSAVAITSHDYLGQETLTE |
Rabbit Polyclonal Anti-FZD9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD9 antibody: synthetic peptide directed towards the N terminal of human FZD9. Synthetic peptide located within the following region: TRNDPHALCMEAPENATAGPAEPHKGLGMLPVAPRPARPPGDLGPGAGGS |
Rabbit Polyclonal Anti-FZD10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD10 antibody: synthetic peptide directed towards the N terminal of human FZD10. Synthetic peptide located within the following region: PIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRF |
Rabbit Polyclonal Anti-WNT16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT16 antibody: synthetic peptide directed towards the middle region of human WNT16. Synthetic peptide located within the following region: KTKRKMRRREKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECN |
Rabbit Polyclonal Anti-WNT16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT16 antibody: synthetic peptide directed towards the C terminal of human WNT16. Synthetic peptide located within the following region: REKDQRKIPIHKDDLLYVNKSPNYCVEDKKLGIPGTQGRECNRTSEGADG |
Rabbit Polyclonal Anti-MFRP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MFRP antibody: synthetic peptide directed towards the N terminal of human MFRP. Synthetic peptide located within the following region: TCGGLLSGPRGFFSSPNYPDPYPPNTHCVWHIQVATDHAIQLKIEALSIE |
Rabbit Polyclonal Anti-FZD8 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD8 antibody: synthetic peptide directed towards the N terminal of human FZD8. Synthetic peptide located within the following region: PDTLCMDYNRTDLTTAAPSPPRRLPPPPPGEQPPSGSGHGRPPGARPPHR |
Rabbit Polyclonal Anti-WNT7B Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-WNT7B antibody: synthetic peptide directed towards the middle region of human WNT7B. Synthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM |
Rabbit Polyclonal Anti-TMCC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMCC2 antibody: synthetic peptide directed towards the N terminal of human TMCC2. Synthetic peptide located within the following region: GETTGANSAGGPTSDAGAAAAPNPGPRSKPPDLKKIQQLSEGSMFGHGLK |
Rabbit Polyclonal Anti-TMCC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TMCC2 antibody is: synthetic peptide directed towards the middle region of Human TMCC2. Synthetic peptide located within the following region: KVDKGDLVALSLPAGHGDTDGPISLDVPDGAPDPQRTKAAIDHLHQKILK |
Rabbit Polyclonal Anti-ACSL6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACSL6 antibody is: synthetic peptide directed towards the middle region of Human ACSL6. Synthetic peptide located within the following region: GPGAIRYIINTADISTVIVDKPQKAVLLLEHVERKETPGLKLIILMDPFE |
Rabbit Polyclonal Anti-PVRL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PVRL3 antibody: synthetic peptide directed towards the N terminal of human PVRL3. Synthetic peptide located within the following region: SGKYICKAVTFPLGNAQSSTTVTVLVEPTVSLIKGPDSLIDGGNETVAAI |
Rabbit Polyclonal Anti-PVRL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PVRL3 antibody: synthetic peptide directed towards the middle region of human PVRL3. Synthetic peptide located within the following region: PDSVKKENKNPVNNLIRKDYLEEPEKTQWNNVENLNRFERPMDYYEDLKM |
Rabbit Polyclonal Anti-PIPOX Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIPOX antibody: synthetic peptide directed towards the C terminal of human PIPOX. Synthetic peptide located within the following region: FVRDHLPDLKPEPAVIESCMYTNTPDEQFILDRHPKYDNIVIGAGFSGHG |
Rabbit Polyclonal Anti-ERMAP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERMAP antibody: synthetic peptide directed towards the middle region of human ERMAP. Synthetic peptide located within the following region: RSELKLKRAAANSGWRRARLHFVAVTLDPDTAHPKLILSEDQRCVRLGDR |
Rabbit Polyclonal Anti-ERMAP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ERMAP antibody: synthetic peptide directed towards the middle region of human ERMAP. Synthetic peptide located within the following region: PANGHWLLRQSRGNEYEALTSPQTSFRLKEPPRCVGIFLDYEAGVISFYN |
Rabbit Polyclonal Anti-LGALS14 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LGALS14 antibody: synthetic peptide directed towards the N terminal of human LGALS14. Synthetic peptide located within the following region: MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDI |
Rabbit Polyclonal Anti-RHCE Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RHCE antibody: synthetic peptide directed towards the N terminal of human RHCE. Synthetic peptide located within the following region: SSKYPRSVRRCLPLCALTLEAALILLFYFFTHYDASLEDQKGLVASYQVG |
Rabbit Polyclonal Anti-RHCE Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RHCE antibody is: synthetic peptide directed towards the middle region of Human RHCE. Synthetic peptide located within the following region: VAWCLPKPLPKGTEDNDQRATIPSLSAMLGALFLWMFWPSVNSPLLRSPI |
Rabbit Polyclonal Anti-ATG9B Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ATG9B antibody: synthetic peptide directed towards the C terminal of human ATG9B. Synthetic peptide located within the following region: WGEAAASILSRPCSSPSQPPSPDEEKPSWSSDGSSPASSPRQQWGTQKAR |
Rabbit Polyclonal Anti-CACNG1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cacng1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AVHNKDKSCEHVTPSGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAI |
Rabbit Polyclonal Anti-TMED10 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMED10 antibody: synthetic peptide directed towards the middle region of human TMED10. Synthetic peptide located within the following region: KLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIF |
Rabbit Polyclonal Anti-TRPC6 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TRPC6 antibody: synthetic peptide directed towards the N terminal of human TRPC6. Synthetic peptide located within the following region: MSQSPAFGPRRGSSPRGAAGAAARRNESQDYLLMDSELGEDGCPQAPLPC |
Rabbit Polyclonal Anti-GPR56 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR56 antibody: synthetic peptide directed towards the N terminal of human GPR56. Synthetic peptide located within the following region: MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMN |
Rabbit Polyclonal Anti-EPHA3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-EPHA3 antibody is: synthetic peptide directed towards the N-terminal region of Human EPHA3. Synthetic peptide located within the following region: SVLDSFGELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDEHYT |
Rabbit Polyclonal Anti-LRP1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LRP1 antibody: synthetic peptide directed towards the middle region of human LRP1. Synthetic peptide located within the following region: ATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCAR |
Rabbit Polyclonal Anti-TNFSF13B Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFSF13B antibody: synthetic peptide directed towards the N terminal of human TNFSF13B. Synthetic peptide located within the following region: ALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAP |
Rabbit Polyclonal Anti-SLC25A6 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC25A6 antibody: synthetic peptide directed towards the N terminal of human SLC25A6. Synthetic peptide located within the following region: LQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIRYFPTQ |
Rabbit Polyclonal Anti-SAMD8 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SAMD8 antibody: synthetic peptide directed towards the middle region of human SAMD8. Synthetic peptide located within the following region: MQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILL |
Germany
Japan
United Kingdom
China
