Rabbit Polyclonal Anti-Vtn Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Vtn antibody is: synthetic peptide directed towards the middle region of Rat Vtn. Synthetic peptide located within the following region: EELCSGKPFDAFTDLKNGSLFAFRGEYCYELDETAVRPGYPKLIQDVWGI |
Rabbit Polyclonal Anti-Urod Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Urod antibody is: synthetic peptide directed towards the N-terminal region of Rat Urod. Synthetic peptide located within the following region: AAQDFFSTCRSPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTM |
Rabbit Polyclonal Anti-F2 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-F2 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: CQLWRSRYPHRPDINSTTHPGADLKENFCRNPDSSTSGPWCYTTDPTVRR |
Rabbit Polyclonal Anti-SLC6A2 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SLC6A2 antibody: synthetic peptide directed towards the middle region of human SLC6A2. Synthetic peptide located within the following region: FTPAAEFYERGVLHLHESSGIHDIGLPQWQLLLCLMVVVIVLYFSLWKGV |
Rabbit Polyclonal Anti-Ambp Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ambp antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: ATLESYVVHTNYDEYAIFLTKKFSHRHGPTITAKLYGREPQLRDSLLQEF |
Rabbit Polyclonal Anti-Apof Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Apof antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LLPAVGTYYNLGTALYYAIKNCTDKAKERGRDGAIDLGYDLLMTMVGMSG |
Rabbit Polyclonal Anti-Stc1 Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Stc1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Stc1. Synthetic peptide located within the following region: EKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEG |
Rabbit Polyclonal Anti-SOCS1 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOCS1 antibody: synthetic peptide directed towards the middle region of human SOCS1. Synthetic peptide located within the following region: RQRNCFFALSVKMASGPTSIRVHFQAGRFHLDGSRESFDCLFELLEHYVA |
Rabbit Polyclonal Anti-Fgf3 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Fgf3 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: KGRPRRGFKTRRTQKSSLFLPRVLGHKDHEMVRLLQSGQPQAPGEGSQPR |
Rabbit Polyclonal Anti-Fbln1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Fbln1 antibody is: synthetic peptide directed towards the C-terminal region of Rat Fbln1. Synthetic peptide located within the following region: FTRPEEIIFLRAVTPLYPANQADIIFDITEGNLRDSFDIIKRYEDGMTVG |
Rabbit Polyclonal Anti-Ogn Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Ogn antibody is: synthetic peptide directed towards the C-terminal region of Rat Ogn. Synthetic peptide located within the following region: LQFNSISSITDDTFCKANDTRYIRERMEEIRLEGNPIALGKHPNSFICLK |
Rabbit Polyclonal Anti-Akt1s1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Akt1s1 antibody is: synthetic peptide directed towards the middle region of Rat Akt1s1. Synthetic peptide located within the following region: DEEDEDEPTETETSGERLGGSDNGGLFMMDEDATLQDLPPFCESDPESTD |
Rabbit Polyclonal Anti-Cpa2 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Cpa2 antibody is: synthetic peptide directed towards the middle region of Rat Cpa2. Synthetic peptide located within the following region: GPGASSSPCSDSYHGPKPNSEVEVKSIVDFIKSHGKVKAFITLHSYSQLL |
Rabbit Polyclonal Anti-sep15 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-sep15 antibody is: synthetic peptide directed towards the C-terminal region of Rat sep15. Synthetic peptide located within the following region: LFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKLER |
Rabbit Polyclonal Anti-PRDX6 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PRDX6 antibody: synthetic peptide directed towards the middle region of human PRDX6. Synthetic peptide located within the following region: ARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVD |
Rabbit Polyclonal Anti-Cib1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Cib1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Cib1. Synthetic peptide located within the following region: GGSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPPEHRTVEESLHT |
Rabbit Polyclonal Anti-Pak4 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Pak4 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: TGFDQHEQKFTGLPRQWQSLIEESARRPKPLIDPACITSIQPGAPKTIVR |
Rabbit Polyclonal Anti-Hat1 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Hat1 antibody is: synthetic peptide directed towards the N-terminal region of Rat Hat1. Synthetic peptide located within the following region: FPEDLENDIRTFFPEYTHQLFGDDETAFGYKGLKILLYYIAGSLSTMFRV |
Rabbit Polyclonal Anti-Nmt2 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Nmt2 antibody is: synthetic peptide directed towards the C-terminal region of Rat Nmt2. Synthetic peptide located within the following region: FDVFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWRCPGTDSEKVGLVLQ |
Rabbit Polyclonal Anti-Pggt1b Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Pggt1b antibody is: synthetic peptide directed towards the C-terminal region of Rat Pggt1b. Synthetic peptide located within the following region: HAYFGICGLSLMEESGICKVHPALNVSTRTSERLRDLHQSWKTKDSKQCS |
Rabbit Polyclonal Anti-St8sia4 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-St8sia4 antibody is: synthetic peptide directed towards the C-terminal region of Rat St8sia4. Synthetic peptide located within the following region: GFWPFPKDLNGKAVKYHYYDDLKYRYFSNASPHRMPLEFKTLNVLHNRGA |
Rabbit Polyclonal Anti-Ftsj3 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ftsj3 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: QVTYVVAKKGVGRKVRRPAGVRGHFKVVDSRMKKDQRAQRKEQKRNHRRK |
Germany
Japan
United Kingdom
China