Rabbit monoclonal anti-CDKN2A / p16INK4A (anti-CD2A1) antibody for SISCAPA, clone OTIR3C4
Applications | SISCAPA |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-CDKN2A / p16INK4A (anti-CD2A1) antibody for SISCAPA, clone OTIR3C4
Applications | SISCAPA |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit monoclonal anti-CHK1 antibody for SISCAPA, clone OTIR3G7
Applications | SISCAPA |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-GADD45B Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GADD45B antibody: synthetic peptide directed towards the middle region of human GADD45B. Synthetic peptide located within the following region: FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW |
Rabbit Polyclonal Bax Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Monoclonal Antibody against CASP3 (Clone E87)
Applications | FC, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Rabbit anti-CDK4 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Center-peptide of human CDK4 |
Rabbit Polyclonal CDKN2A Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CDKN2A antibody was raised against a 18 amino acid peptide from near the amino terminus of human CDKN2A. |
Rabbit Polyclonal antibody to PIG3 (tumor protein p53 inducible protein 3)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 332 of PIG3 (Uniprot ID#Q53FA7) |
Rabbit anti-CYCS Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CYCS |
Rabbit polyclonal Caspase 9 (Cleaved-Asp315) antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Caspase 9. |
CASP3 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human CASP3 |
CASP3 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CASP3 |
Rabbit monoclonal antibody against PTEN Phospho (Ser380) (clone EPR2062Y ) (Phospho-Specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Modifications | Phospho-specific |
Rabbit polyclonal anti-Cyclin E1 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Cyclin E1. |
Rabbit Polyclonal Anti-KIRREL2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | KIRREL2 antibody was raised against a 17 amino acid peptide near the carboxy terminus of human KIRREL2. |
Rabbit Polyclonal p53AIP1 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | p53AIP1 antibody was raised against a 15 amino acid peptide from near the amino terminus of human p53AIP1. |
Rabbit anti-CDK1 Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Center-peptide of human CDK1 |
Rabbit anti-SFN Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SFN |
Rabbit anti-GADD45A Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human GADD45A |
Rabbit polyclonal MDM2 (Ab-166) antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human MDM2 around the phosphorylation site of serine 166 (A-I-SP-E-T). |
Bax Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human Bax |
Rabbit Polyclonal p53 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-p53 antibody: human p53 (tumor protein p53), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of the protein. |
Rabbit polyclonal APAF-1-ALT antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human APAF-1-ALT. |
Rabbit Polyclonal p21 Cip1 (Thr145) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human p21 Cip1 around the phosphorylation site of Threonine 145 |
Modifications | Phospho-specific |
Rabbit polyclonal p16-INK4a (Phospho-Ser152) antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p16-INK4a around the phosphorylation site of serine 152 (G-P-SP-D-I). |
Modifications | Phospho-specific |
Rabbit anti-P16 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | C term -peptide of human P16 |
DDB2 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human DDB2 |
Rabbit anti-SIAH1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SIAH1 |
Phospho-CDK1-T161 Rabbit Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding T161 of human CDK1 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-NDST2 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | NDST2 antibody was raised against a 16 amino acid peptide near the amino terminus of human NDST2 |
Rabbit Polyclonal Caspase-8 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Caspase-8 antibody was raised against a 16 amino acid peptide from near the carboxy-terminus of human Caspase-8 isoform A. |
Rabbit polyclonal Caspase 3 (Cleaved-Asp175) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Caspase 3. |
CCND1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CCND1 |
CDKN1A Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CDKN1A |
CCNB1 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human CCNB1 |
CHEK2 Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CHEK2 |
Phospho-CDK2-T160 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding T160 of human CDK2 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-SERPINB5 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SERPINB5 antibody: synthetic peptide directed towards the middle region of human SERPINB5. Synthetic peptide located within the following region: NSVNDQTKILVVNAAYFVGKWMKKFPESETKECPFRLNKTDTKPVQMMNM |
Rabbit Monoclonal Antibody against CASP3 (Clone E83-103)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit polyclonal Caspase 9 (Tyr153) antibody(Phospho-specific)
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of tyrosine 153 (L-A-YP-I-L). |
Modifications | Phospho-specific |
Rabbit polyclonal CASP8 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CASP8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 432-461 amino acids from the C-terminal region of human CASP8. |
Rabbit Polyclonal p53R2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | p53R2 antibody was raised against a synthetic peptide corresponding to amino acids 2 to 17 of human p53R2 . |
Rabbit Polyclonal KAI1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | KAI1 antibody was raised against a 15 amino acid peptide from near the carboxy terminus of human KAI1. |
Rabbit polyclonal antibody to SESN3 (sestrin 3)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 21 and 296 of SESN3 (Uniprot ID#P58005) |
Rabbit polyclonal CDK4 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This CDK4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 273-305 amino acids from the C-terminal region of human CDK4. |
Anti-Human IGF-I Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IGF-I |
Phospho-CDK6-Y13 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding Y13 of human CDK6 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CCNB3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CCNB3 antibody: synthetic peptide directed towards the C terminal of human CCNB3. Synthetic peptide located within the following region: ISELHPLVRQLNKLLTFSSYDSLKAVYYKYSHPVFFEVAKIPALDMLKLE |
Rabbit Polyclonal Antibody against MDM2 (C-term)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This Mdm2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 393-424 amino acids from the C-terminal region of human Mdm2. |
Rabbit monoclonal antibody against Phospho Tuberin (pS939)(EP1062Y) (Phospho-Specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Modifications | Phospho-specific |