Primary Antibodies

View as table Download

Rabbit Polyclonal Aggrecan Neoepitope Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Porcine
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a region of human Aggrecan (within residues 350-400). [UniProt# P16112]

Rabbit Polyclonal Folliculin Antibody

Applications WB
Reactivities Bovine, Canine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen N-terminal partial recombinant human FLCN protein [Swiss-Prot# Q8NFG4] expressed in E. coli.

Rabbit polyclonal p38 Antibody

Applications WB
Reactivities Bovine, Canine, Chicken, Guinea Pig, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Pig
Conjugation Unconjugated
Immunogen A 20 residue synthetic peptide based on the human p38 with the cysteine residue added and coupled to KLH.

Rabbit Polyclonal DUOX2 Antibody

Applications WB
Reactivities Canine, Human, Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human protein (within residues 400-500). [Swiss-Prot# Q9NRD8]

Rabbit Polyclonal GPR83 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Chicken, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 200-250 of human GPR83 was used as the immunogen for this antibody.

Rabbit Polyclonal GFAP Antibody

Applications IF, WB
Reactivities Bovine, Canine, Chicken, Feline, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GFAP purified from bovine spinal cord. [UniProt# Q28115]

Rabbit Polyclonal SR1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Bovine, Canine, Equine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids 45-76 of human Sorcin was used as immunogen, GenBank no NP-003121.

Rabbit Polyclonal SOX9 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Canine, Feline, Goat, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 225-275 of human SOX9 was used as the immunogen for this antibody.

Rabbit polyclonal anti canine / mouse / porcine / rat Peptide YY

Applications ELISA
Reactivities Canine, Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide H-Tyr-Pro-Ala-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala- Ser-Pro-Glu-Glu-Leu-Ser-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn- Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 coupled to a carrier protein.

Tacr3 rabbit polyclonal antibody

Applications IHC
Reactivities Canine, Gerbil, Human, Mouse, Rat
Conjugation Unconjugated

Macrophage Scavenger Receptor I (MSR1) (300-400) rabbit polyclonal antibody

Applications IF, IHC, WB
Reactivities Bovine, Canine, Human, Mouse, Primate, Rat
Conjugation Unconjugated

Semaphorin 3B (SEMA3B) (100-200) rabbit polyclonal antibody

Applications IF, IHC, WB
Reactivities Bovine, Canine, Human, Mouse, Primate, Rat
Conjugation Unconjugated

Cripto1 (TDGF1) rabbit polyclonal antibody

Applications FC, IF, WB
Reactivities Bovine, Canine, Human, Mouse, Primate, Rat
Conjugation Unconjugated

Rabbit Polyclonal Capicua Antibody

Applications WB
Reactivities Canine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The epitope recognized by this antibody maps to a C-terminal region within residue 1500- 1608 of human Capicua. [NCBI# NP_055940.3]

Rabbit Polyclonal Anti-SOD (Mn) Antibody

Applications IF, WB
Reactivities Human, Rat, Mouse, Bovine, Canine, Chicken, Dosophila, Guinea Pig, Pig, Hamster, Monkey, Rabbit, Sheep, Xenopus
Conjugation Unconjugated
Immunogen Rat Mn SOD

Rabbit Polyclonal HIF-1 alpha Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat, Canine, Guinea Pig, Primate, Xenopus
Conjugation Unconjugated
Immunogen Fusion protein made to an internal sequence of human HIF-1 alpha (containing amino acids 432-528) [UniProt Q16665]

Rabbit Polyclonal active/cleaved Caspase 3 Antibody

Applications IHC
Reactivities Human, Mouse, Rat, Canine, Gerbil
Conjugation Unconjugated
Immunogen Recombinant catalytically active human caspase-3 protein was used as immunogen.

Rabbit Polyclonal Beclin 1/ATG6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Canine, Porcine, Primate
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of human Beclin 1 (within residues 150-300). [Swiss-Prot# Q14457]

Rabbit Polyclonal LIMPII/lpg85 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Canine, Primate
Conjugation Unconjugated
Immunogen A C-terminal synthetic peptide made to the mouse LIMPII/lgp85 protein sequence. [UniProt# O35114]

Rabbit Polyclonal beta-Arrestin 2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Equine, Primate
Conjugation Unconjugated
Immunogen A peptide sequence corresponding to an area between amino acids 1 and 50 of human ARRB2 was used as the immunogen for the antibody, Gen Bank no. gb:ABG47460.1.

Rabbit Polyclonal GRAIL/RNF128 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Canine, Equine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids portion of amino acids 227-269 of human GRAIL was used as immunogen, GenBank no. NP_919445.1.

Rabbit Polyclonal Anti-NUCB2 Antibody

Applications IHC, WB
Reactivities Canine, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NUCB2 antibody: synthetic peptide directed towards the middle region of human NUCB2. Synthetic peptide located within the following region: MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE

Bmi1 (COMMD3-BMI1) (1-100) rabbit polyclonal antibody

Applications IF, WB
Reactivities Bovine, Canine, Chicken, Feline, Human, Mouse, Primate, Rabbit, Rat, Zebrafish
Conjugation Unconjugated

Angiopoietin 1 (ANGPT1) (C-term) rabbit polyclonal antibody

Applications IHC, WB
Reactivities Canine, Human, Rabbit, Rat
Conjugation Unconjugated

Rabbit polyclonal Cpn10 Antibody

Applications IHC, WB
Reactivities Bovine, Canine, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep, Xenopus, Pig
Conjugation Unconjugated
Immunogen Human Cpn10 peptide AA 91-101

Rabbit Polyclonal Caspase-6 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Canine
Conjugation Unconjugated
Immunogen Recombinant catalytically active human Caspase-6 protein was used as immunogen.

Rabbit Polyclonal Caspase-9 Antibody

Applications IHC
Reactivities Human, Mouse, Rat, Canine, Gerbil
Conjugation Unconjugated
Immunogen Recombinant catalytically active human Caspase-9 protein was used as immunogen (NP_001220).

Rabbit Polyclonal Caspase-9 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Canine, Gerbil
Conjugation Unconjugated
Immunogen Recombinant full-length human Caspase-9 protein (pro-form) was used as an immunogen (NP_001220).

Rabbit Polyclonal beta Tubulin Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Chicken, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a portion of amino acids 400-450 of human b-tubulin was used as immunogen for this antibody, GenBank no. gi|27227551|gb|AAN85571.1|.

Rabbit Polyclonal Smad2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Chicken, Primate
Conjugation Unconjugated
Immunogen Amino acids 234-249 (DQQLNQSMDTGSPAEL) of human SMAD2 protein was used as the immunogen.

Rabbit Polyclonal PLK1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Porcine, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 100-200 of human PLK1 was used as the immunogen.

Rabbit Polyclonal HDAC9 Antibody

Applications WB
Reactivities Human, Bovine, Canine, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 100-150 of human HDAC-9 was used as the immunogen.

Rabbit Polyclonal NQO-1 Antibody

Applications IHC, WB
Reactivities Canine, Human, Primate
Conjugation Unconjugated
Immunogen A portion of amino acid 250-274 of human NQO1 was used as the immunogen.

Rabbit Polyclonal HDAC9 [p Ser155] Antibody

Applications WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide containing phospho-serine 155 of human HDAC-7 was used as the immunogen.

Rabbit Polyclonal AMPD1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 140-190 of human AMPDA1 was used as the immunogen.

Rabbit Polyclonal HIPK3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Canine, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 850-900 of human HIPK3 was used as the immunogen.

Rabbit Polyclonal Rab7a Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Chicken, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 90-140 of human Rab7 protein was used as the immunogen for this antibody.

Rabbit Polyclonal IFRD1 Antibody

Applications IHC, WB
Reactivities Human, Bovine, Canine, Porcine, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 70-120 of human Tis7 was used as the immunogen.

Rabbit Polyclonal S1P5/EDG-8 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Canine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids 15-55 of human Edg8 was used as the immunogen, GenBank no NP_110387.

Rabbit Polyclonal 14-3-3 sigma/Stratifin Antibody

Applications IHC, WB
Reactivities Human, Amphibian, Bovine, Canine, Equine, Opossum
Conjugation Unconjugated
Immunogen A portion of amino acids 120-170 of human 14-3-3 sigma was used as the immunogen for this antibody.

Rabbit Polyclonal AIF Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine
Conjugation Unconjugated
Immunogen (aa 151-170); human

Rabbit Polyclonal Anti-TNFRSF9 Antibody

Applications WB
Reactivities Canine, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFRSF9 antibody: synthetic peptide directed towards the C terminal of human TNFRSF9. Synthetic peptide located within the following region: LTLRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL

Rabbit Polyclonal Kv1.2 Antibody

Applications WB
Reactivities Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Xenopus
Conjugation Unconjugated
Immunogen Synthetic peptide made to a portion of rat Kv1.2 (within residues 325-375). [Swiss-Prot# P63142]

Rabbit Polyclonal Kv1.2 Antibody

Applications IF
Reactivities Bovine, Canine, Human, Mouse, Porcine, Rat, Xenopus, Zebrafish
Conjugation Unconjugated
Immunogen Synthetic peptide made to a portion of rat Kv1.2 (within residues 50-100). [Swiss-Prot# P63142]

Rabbit Polyclonal SEMA3B Antibody

Applications WB
Reactivities Bovine, Canine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human SEMA 3B protein sequence (between residues 100-200).

Rabbit polyclonal Hsp60 Antibody

Applications WB
Reactivities Bovine, Canine, Chicken, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen Human Hsp60 produced through recombinant DNA methods in E.coli

Rabbit polyclonal SOD (Mn) Antibody

Applications IHC
Reactivities Bovine, Canine, Chicken, Guinea Pig, Gerbil, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Sheep, Xenopus, Pig
Conjugation Unconjugated
Immunogen Human Mn SOD

Rabbit polyclonal GRP78 (Bip) Antibody

Applications WB
Reactivities Human, Mouse, Rat, Canine. Other species not yet tested
Conjugation Unconjugated
Immunogen Full length human GRP78 (Bip) his tagged at the N terminus

Rabbit Polyclonal Anti-Calcineurin A Antibody

Reactivities Canine, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen Human Calcineurin A peptide (AA 364-283)

Rabbit Polyclonal Anti-TNF-R1 Antibody

Reactivities Bovine, Canine, Human, Monkey, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen Peptide corresponding to AA 20-43 of the mouse TNF-R1 sequence, identical to rat and human over those residues