Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
14 3 3 gamma (YWHAG) mouse monoclonal antibody, clone AT4B9, Purified
| Applications | ELISA, IF, WB |
| Reactivities | Human |
c-Myc (MYC) rabbit polyclonal antibody, Biotin
| Applications | ELISA, IHC, WB |
| Conjugation | Biotin |
| Immunogen | Purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide. The sequence corresponds to aa 410-419 of human c-Myc. |
c-Myc (MYC) rabbit polyclonal antibody, HRP
| Applications | ELISA, IHC, WB |
| Conjugation | HRP |
| Immunogen | Purified from whole rabbit serum prepared by repeated immunizations with Myc epitope tag peptide E-Q-K-L-I-S-E-E-D-L conjugated to KLH using maleimide. The sequence corresponds to aa 410-419 of human c-Myc. |
Rabbit Polyclonal CDKN2A/p16INK4a Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal MDM2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal MDM2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Rabbit Polyclonal MDM2 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Cdc25C Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
CDK4 mouse monoclonal antibody, clone AT6D10, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
CDK4 mouse monoclonal antibody, clone AT6D10, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
BUB3 mouse monoclonal antibody, clone AT2H6, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
BUB3 mouse monoclonal antibody, clone AT2H6, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Cyclin H mouse monoclonal antibody, clone AT3G6, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Cyclin H mouse monoclonal antibody, clone AT3G6, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
SA2 (STAG2) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, WB |
| Reactivities | Bovine, Canine, Human, Mouse, Porcine, Rat |
| Immunogen | Peptide with sequence C-SRGSTVRSKKSKPST, from the internal region of the protein sequence according to NP_001036214.1; NP_006594.3. |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Anti-TP53 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 1-233 amino acids of human tumor protein p53 |
Anti-CDC20 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 182-480 amino acids of Human Cell division cycle protein 20 homolog |
Anti-PCNA Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 9-252 amino acids of Human Proliferating cell nuclear antigen |
Anti-SMAD4 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 14-227 amino acids of Human Mothers against decapentaplegic homolog 4 |
Anti-YWHAE Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 254 amino acids of Human Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, epsilon polypeptide |
Anti-GADD45G Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-E2F2 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-CDC25A Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 376-482 amino acids of human cell division cycle 25 homolog A (S. pombe) |
Anti-CDKN1A Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 6-149 amino acids of human cyclin-dependent kinase inhibitor 1A (p21, Cip1) |
Anti-CDKN1A Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 5-164 amino acids of human cyclin-dependent kinase inhibitor 1A (p21, Cip1) |
Anti-CDK6 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 13-300 amino acids of Human Cyclin-dependent kinase 6 |
Anti-ANAPC10 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-MCM3 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human minichromosome maintenance complex component 3 |
Rabbit Polyclonal Anti-ANAPC13 Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ANAPC13 |
USD 399.00
In Stock
USD 399.00
In Stock
Active filters
Applications
- ELISA
Pathways
- Cell cycle
Filter by
Category
Target Symbol
- MYC (13)
- BUB1B (5)
- HDAC1 (5)
- PLK1 (5)
- MDM2 (4)
- PRKDC (4)
- TP53 (4)
- CCNH (3)
- EP300 (3)
- SMAD3 (3)
- BUB3 (2)
- CDC25A (2)
- CDK4 (2)
- CDK6 (2)
- CDKN1A (2)
- CHEK2 (2)
- PCNA (2)
- STAG2 (2)
- TGFB1 (2)
- YWHAG (2)
- YWHAQ (2)
- ANAPC10 (1)
- ANAPC13 (1)
- ANAPC4 (1)
- ANAPC5 (1)
- ANAPC7 (1)
- ATR (1)
- CCNA1 (1)
- CCNA2 (1)
- CCNB1 (1)
- CCNB2 (1)
- CCND1 (1)
- CCNE2 (1)
- CDC16 (1)
- CDC20 (1)
- CDC25C (1)
- CDC27 (1)
- CDKN1B (1)
- CDKN2A (1)
- CDKN2C (1)
- CREBBP (1)
- E2F1 (1)
- E2F2 (1)
- FZR1 (1)
- GADD45G (1)
- HDAC2 (1)
- MCM3 (1)
- MCM6 (1)
- SFN (1)
- SKP1 (1)
- SMAD2 (1)
- SMAD4 (1)
- SMC1A (1)
- STAG1 (1)
- TFDP1 (1)
- YWHAE (1)
Reactivities
Antibody Hosts
Clonalities
Conjugates
Assay Types
Assay Platforms
Families
- Druggable Genome (101)
- Transcription Factors (45)
- Stem cell - Pluripotency (39)
- Protein Kinase (21)
- Stem cell relevant signaling - JAK/STAT signaling pathway (18)
- Embryonic stem cells (17)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (17)
- Stem cell relevant signaling - Wnt Signaling pathway (14)
- Induced pluripotent stem cells (13)
- ES Cell Differentiation/IPS (6)
- Stem cell relevant signaling - DSL/Notch pathway (6)
- Adult stem cells (5)
- Cancer stem cells (4)
- Phosphatase (3)
- Secreted Protein (3)