Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal PPARG Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARG antibody: human PPARG (peroxisome proliferator-activated receptor gamma), using a KLH-conjugated synthetic peptide containing a sequence from the central part of the protein. |
USD 280.00
2 Weeks
USD 300.00
2 Weeks
p53 (TP53) (Wild type + Mutant) (20-31) mouse monoclonal antibody, clone Bp53-11, Aff - Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human |
Rabbit Polyclonal HDAC2 Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
USD 440.00
2 Weeks
EP300 rabbit polyclonal antibody, Supernatant
| Applications | ELISA, EMSA, IP, WB |
| Reactivities | Human |
| Immunogen | P300 peptide corresponding to a region near the N-terminus of the Human protein conjugated to KLH. |
Rabbit Polyclonal Caspase 8 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
Rabbit Polyclonal Beta 2 Adaptin Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
DNAL1 mouse monoclonal antibody, clone AT29E4, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
DNAL1 mouse monoclonal antibody, clone AT29E4, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: PSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPPVAPAPAAPTPAAP |
Rabbit Polyclonal anti-TP53 antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
CREB1 pSer133 mouse monoclonal antibody, clone A3A4, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
CREB1 pSer133 mouse monoclonal antibody, clone B1C4, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-TP53 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 1-233 amino acids of human tumor protein p53 |
Anti-SOD2 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 25-222 amino acids of human superoxide dismutase 2, mitochondrial |
Anti-CASP9 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 139-389 amino acids of Human Caspase-9 |
Anti-BAX Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 2-172 amino acids of human BCL2-associated X protein |
Anti-TGM2 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human transglutaminase 2 (C polypeptide, protein-glutamine-gamma-glutamyltransferase) |
Anti-CREB1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 12-341 amino acids of human cAMP responsive element binding protein 1 |
Anti-CASP3 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 1-269 amino acids of human caspase 3, apoptosis-related cysteine peptidase |
Anti-COX5B Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 1-139 amino acids of human cytochrome c oxidase subunit Vb |
Anti-COX6B1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-COX7B Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 1-79 amino acids of human cytochrome c oxidase subunit VIIb |
Anti-BDNF Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 19-247 amino acids of human brain-derived neurotrophic factor |
Active filters
Applications
- ELISA
Pathways
- Huntington's disease
Filter by
Category
Target Symbol
- CREB1 (5)
- HDAC1 (5)
- BAX (4)
- TP53 (4)
- EP300 (3)
- POLR2A (3)
- BDNF (2)
- CASP3 (2)
- CASP9 (2)
- DNAL1 (2)
- PPARG (2)
- AP2B1 (1)
- AP2M1 (1)
- AP2S1 (1)
- ATP5E (1)
- ATP5F1A (1)
- CASP8 (1)
- CLTC (1)
- COX4I1 (1)
- COX5B (1)
- COX6B1 (1)
- COX7B (1)
- CREBBP (1)
- GPX1 (1)
- HDAC2 (1)
- HTT (1)
- NDUFB9 (1)
- SOD2 (1)
- SP1 (1)
- TFAM (1)
- TGM2 (1)
Reactivities
Antibody Hosts
Clonalities
Conjugates
Assay Types
Families
- Druggable Genome (41)
- Transcription Factors (23)
- Stem cell - Pluripotency (13)
- Adult stem cells (7)
- Transmembrane (7)
- ES Cell Differentiation/IPS (5)
- Protease (5)
- Stem cell relevant signaling - DSL/Notch pathway (5)
- Embryonic stem cells (2)
- Induced pluripotent stem cells (2)
- Nuclear Hormone Receptor (2)
- Secreted Protein (2)
- Stem cell relevant signaling - JAK/STAT signaling pathway (1)