beta Catenin (CTNNB1) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 653-681 amino acids from the C-terminal region of Human Catenin beta-1. |
beta Catenin (CTNNB1) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 653-681 amino acids from the C-terminal region of Human Catenin beta-1. |
Rabbit Polyclonal Bax Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit polyclonal EGFR (Ab-1172) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
MSH6 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Monkey |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MSH6 |
Rabbit Polyclonal Anti-FZD7 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FZD7 antibody: synthetic peptide directed towards the C terminal of human FZD7. Synthetic peptide located within the following region: PDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV |
Rabbit anti-CYCS Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CYCS |
Rabbit polyclonal Caspase 9 (Cleaved-Asp315) antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Caspase 9. |
CASP3 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human CASP3 |
Rabbit Polyclonal Anti-BAD Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human BAD |
Rabbit Polyclonal Anti-GRB2 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Rabbit Polyclonal Anti-MSH6 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MSH6 antibody: synthetic peptide directed towards the N terminal of human MSH6. Synthetic peptide located within the following region: ISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKR |
Rabbit Polyclonal Anti-FOS Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human FOS |
Rabbit Polyclonal Anti-RAF1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human RAF1 |
PI 3 Kinase p85 alpha (PIK3R1) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 470-510 of Human PI3K p85α. |
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit polyclonal TGFBR2 (Ab-250) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TGFBR2 around the phosphorylation site of serine 250 (D-R-SP-D-I). |
Rabbit polyclonal Akt (Ser473) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt |
Modifications | Phospho-specific |
Rabbit anti-BIRC5 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant Protein of human BIRC5 |
Bax Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human Bax |
Rabbit Polyclonal Anti-FZD9 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FZD9 antibody: synthetic peptide directed towards the N terminal of human FZD9. Synthetic peptide located within the following region: RPPGDLGPGAGGSGTCENPEKFQYVEKSRSCAPRCGPGVEVFWSRRDKDF |
Frizzled 2 (FZD2) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Peptide with sequence from the internal region of the protein sequence according to NP_001457.1. |
Rabbit Polyclonal Antibody against PIK3CA (Center)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA. |
Rabbit polyclonal IGF1R (Tyr1346) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IGF1R around the phosphorylation site of tyrosine 1346 (Q-P-YP-A-H). |
Modifications | Phospho-specific |
Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L). |
Modifications | Phospho-specific |
Rabbit anti-SMAD4 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SMAD4 |
Rabbit Polyclonal Anti-JUN Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human JUN |
Rabbit Polyclonal Anti-LEF1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LEF1 |
Rabbit Polyclonal Anti-MAP2K1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MAP2K1 |
Rabbit Polyclonal Anti-MLH1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MLH1 |
PDGF Receptor alpha (PDGFRA) (1035-1053) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, IP, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide KLH-conjugated corresponding to amino acids 1000 to the C-term of Human PDGF |
Rabbit polyclonal Caspase 3 (Cleaved-Asp175) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Caspase 3. |
Rabbit polyclonal TGFBR2 Antibody (N-term)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This TGFBR2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-40 amino acids from the N-terminal region of human TGFBR2. |
Rabbit polyclonal SMAD3-S208 Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
CCND1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CCND1 |
Rabbit Polyclonal Anti-FZD4 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FZD4 antibody: synthetic peptide directed towards the middle region of human FZD4. Synthetic peptide located within the following region: GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV |
Rabbit Polyclonal Anti-MSH2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MSH2 antibody: synthetic peptide directed towards the N terminal of human MSH2. Synthetic peptide located within the following region: GNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGVKMSAVDG |
Rabbit Polyclonal c-jun Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
c Fos (FOS) (4-17) rabbit polyclonal antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
beta Catenin (CTNNB1) rabbit polyclonal antibody, Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse |
Immunogen | beta-specific amino acid sequence chosen from the middle of the beta Catenin (p120) protein. |
Rabbit Polyclonal Antibody against BRAF (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This B-RAF antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 424-453 amino acids from the Central region of human B-RAF. |
Rabbit anti-BAD (Phospho-Ser112) polyclonal antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanBAD around the phosphorylation site of serine 112 (H-S-SP-Y-P). |
Modifications | Phospho-specific |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
Modifications | Phospho-specific |
Rabbit anti-PDGFRB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PDGFRB |
c-Myc (MYC) chicken polyclonal antibody, Aff - Purified
Applications | ELISA, IF, IHC, IP, WB |
Reactivities | Human |
Immunogen | Synthetic peptide containing the Human c-myc epitope (i.e., EQKLISEEDL) conjugated to KLH. The first injection included complete Freund's adjuvant; subsequent injections included incomplete Freund's adjuvant. Eggs were collected after the fourth injection, and antibodies were purified from the yolks using a proprietary method that yields a purity of >90%. |
Rabbit Polyclonal Antibody against PIK3R1 (N-term L11)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This PI3KR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PI3KR1. |
Rabbit Polyclonal Antibody against AKT2 (N-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-123 amino acids from the N-terminal region of human AKT2. |
Rabbit Polyclonal Akt1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Akt1 antibody was raised against a 16 amino acid peptide from near the amino-terminus of human Akt1. |
Rabbit Polyclonal IGF1 Receptor Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Primate, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human IGF1R protein (between residues 700-800) [UniProt P08069] |
Rabbit polyclonal anti-PDGFR a antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PDGFR a. |
Rabbit Polyclonal Fos Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human Fos. |